Potri.010G007700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73325 62 / 1e-11 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G007822 402 / 3e-145 AT1G17860 56 / 1e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007500 402 / 4e-145 AT1G73325 54 / 7e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G010111 401 / 7e-145 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007800 401 / 8e-145 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007911 401 / 8e-145 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007922 325 / 6e-115 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007900 325 / 6e-115 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007811 325 / 6e-115 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124500 235 / 3e-79 AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022302 68 / 2e-13 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 67 / 2e-13 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 67 / 3e-13 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 64 / 2e-12 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 64 / 3e-12 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 63 / 4e-12 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 62 / 9e-12 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 62 / 9e-12 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 63 / 1e-11 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 62 / 1e-11 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Potri.010G007700.1 pacid=42799744 polypeptide=Potri.010G007700.1.p locus=Potri.010G007700 ID=Potri.010G007700.1.v4.1 annot-version=v4.1
ATGAAGATCACTGAAGTTCTTGGGCTCTCGTTCCTTCTCTTTGCCTTCATAGGAACTTCATTTCCTGAGGCCGTTCATGCCAAAGATGCTGCAGCAGTGC
TCGATGTCTTCGGTCATGAGGTGCAAGCTGGTGCTCGTTATTTAATCGTAGCCCCCTCGACTGACAATACAACAACTCTTGCAGTCACTATCAATGGCCA
GGTCTTATGCAATTCAGATGTTATACTTTCCACATTGAACGAGAGCCTCCCAATAACATTTTCACCAGTTATGCAATCCACCGATAGTGTCATCCGCGAA
GGAACTCATCTAAATGTGAACTTTGCAGGGCCAATTGCCATGTGCGCAATGGCAGGCGTGACACCCATGTGGAAAATCCGATTCAGTACAACACTGAAAG
GATACATTGTGACCACTGGAGGTGTTGATAGATTGAATCGGTTTAAGATCACCAAGTATGAAGGTGATAATAGTTTTTATCAGCTTTCTTTTTGTCCAAT
GTCCGAACCCTTCTGTGAATGCTCATGCGTCCCAGTTGGCGTCAACGGTGACAAGAACTTGGTTCCTGGTGCCGGCCCTCTTCTTGTTATGTTTGAACCA
GATGAATAG
AA sequence
>Potri.010G007700.1 pacid=42799744 polypeptide=Potri.010G007700.1.p locus=Potri.010G007700 ID=Potri.010G007700.1.v4.1 annot-version=v4.1
MKITEVLGLSFLLFAFIGTSFPEAVHAKDAAAVLDVFGHEVQAGARYLIVAPSTDNTTTLAVTINGQVLCNSDVILSTLNESLPITFSPVMQSTDSVIRE
GTHLNVNFAGPIAMCAMAGVTPMWKIRFSTTLKGYIVTTGGVDRLNRFKITKYEGDNSFYQLSFCPMSEPFCECSCVPVGVNGDKNLVPGAGPLLVMFEP
DE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73325 Kunitz family trypsin and prot... Potri.010G007700 0 1
AT1G73325 Kunitz family trypsin and prot... Potri.010G007500 1.73 0.9796
AT1G17860 Kunitz family trypsin and prot... Potri.010G007800 3.16 0.9781
AT1G17860 Kunitz family trypsin and prot... Potri.010G007822 3.87 0.9731
AT1G17860 Kunitz family trypsin and prot... Potri.010G010111 4.47 0.9715
AT1G17860 Kunitz family trypsin and prot... Potri.010G007911 5.00 0.9665
AT1G17860 Kunitz family trypsin and prot... Potri.010G007900 9.89 0.9186
AT1G63410 Protein of unknown function (D... Potri.003G125200 13.82 0.7829
AT2G19080 metaxin-related (.1) Potri.001G065336 20.63 0.9316
AT1G17860 Kunitz family trypsin and prot... Potri.010G007922 23.06 0.8989
Potri.006G038300 26.45 0.9285

Potri.010G007700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.