Potri.010G007811 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73325 40 / 0.0003 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G007900 345 / 6e-123 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007922 345 / 6e-123 AT1G17860 53 / 1e-08 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007911 279 / 1e-96 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007800 279 / 1e-96 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G010111 279 / 1e-96 AT1G17860 57 / 4e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007822 278 / 4e-96 AT1G17860 56 / 1e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007700 275 / 7e-95 AT1G73325 62 / 1e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.010G007500 269 / 1e-92 AT1G73325 54 / 7e-09 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G124500 204 / 3e-67 AT1G73325 61 / 4e-11 Kunitz family trypsin and protease inhibitor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007890 55 / 5e-09 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 54 / 1e-08 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 53 / 2e-08 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 53 / 2e-08 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039163 52 / 3e-08 AT1G17860 167 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013770 50 / 2e-07 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 50 / 2e-07 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 49 / 4e-07 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 49 / 9e-07 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 48 / 1e-06 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Potri.010G007811.1 pacid=42799269 polypeptide=Potri.010G007811.1.p locus=Potri.010G007811 ID=Potri.010G007811.1.v4.1 annot-version=v4.1
ATGGAGATCACTAAATTTCTAGGGTTCTCCTTCCTTCTCTTTGCCTTCGCAGCAACTTCATTTCCTGAGGCCGTTCATGCCAAAGATGCTGCAGCAGTGC
TCGATGTCTTCGGTCATGAGGTGCAAGCTGGTGCTCGTTATTTAATCGTAGCCCCCTCGACTGACAATACAACAACTCTTGCGGTCACTGCGACTAGCAA
GATCATATGCAATTCAGATGTTATACTTTCCACTTTGAACGAGAGCCTCCCAATAACATTTTCACCTGCTATAAAATCCAACGATGGTGTCATCCGTGAA
GGCTCTTATCTAAATGTGAACTTTGATGCACCCTCATGTAGGATGGGGGGCGTGACAACGATGTGGATGATTGAATCGGAAGGATTGATTGTGACCACAG
GAGGTGTTGATAGATTGAATCGGTTTAAGATCACCAAGTATGAAGGTGATAATAGTTTTTATCAGCTTTCTTTTTGTCCAATGTCCGAACCCTTCTGTGA
ATGCTCATGCGTCCCAGTTGGCGTCAACAGTGACAAGCACTTGGCTCCCAATGTCGGCCCTCTTCTTGTGATGTTCGAACCAGATGCATATTGA
AA sequence
>Potri.010G007811.1 pacid=42799269 polypeptide=Potri.010G007811.1.p locus=Potri.010G007811 ID=Potri.010G007811.1.v4.1 annot-version=v4.1
MEITKFLGFSFLLFAFAATSFPEAVHAKDAAAVLDVFGHEVQAGARYLIVAPSTDNTTTLAVTATSKIICNSDVILSTLNESLPITFSPAIKSNDGVIRE
GSYLNVNFDAPSCRMGGVTTMWMIESEGLIVTTGGVDRLNRFKITKYEGDNSFYQLSFCPMSEPFCECSCVPVGVNSDKHLAPNVGPLLVMFEPDAY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G17860 Kunitz family trypsin and prot... Potri.010G007811 0 1
Potri.019G002628 7.48 0.8165
Potri.010G007833 8.36 0.8141
AT5G38280 PR5K PR5-like receptor kinase (.1) Potri.015G122000 8.48 0.8158
AT5G26594 ARR24 response regulator 24 (.1) Potri.019G024900 13.03 0.7957
AT3G19280 FUCTA, FUCT1, A... fucosyltransferase 11 (.1) Potri.019G091200 13.67 0.7957 FUCT3.1
AT2G35615 Eukaryotic aspartyl protease f... Potri.003G105300 14.00 0.7751
AT5G28780 PIF1 helicase (.1) Potri.011G042150 14.28 0.7957
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Potri.004G036000 18.89 0.7400
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Potri.011G028901 19.89 0.7190
AT3G46280 protein kinase-related (.1) Potri.005G043700 20.78 0.6926

Potri.010G007811 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.