Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17080 74 / 9e-18 Plant self-incompatibility protein S1 family (.1) AT5G12060 73 / 3e-17 Plant self-incompatibility protein S1 family (.1) AT4G24975 72 / 9e-17 Plant self-incompatibility protein S1 family (.1) AT4G24974 70 / 5e-16 Plant self-incompatibility protein S1 family (.1) AT5G06030 69 / 9e-16 Plant self-incompatibility protein S1 family (.1) AT4G16195 69 / 1e-15 Plant self-incompatibility protein S1 family (.1) AT4G24973 67 / 4e-15 Plant self-incompatibility protein S1 family (.1) AT1G04645 64 / 5e-14 Plant self-incompatibility protein S1 family (.1) AT5G12070 64 / 8e-14 Plant self-incompatibility protein S1 family (.1) AT5G06020 62 / 5e-13 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G148630 [exp] 77 / 1e-18 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 74 / 1e-17 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 73 / 3e-17 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.016G066900 [exp] 70 / 6e-16 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.018G148700 [exp] 69 / 1e-15 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 68 / 2e-15 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 64 / 9e-14 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.017G144361 [exp] 62 / 6e-13 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.006G170200 [exp] 61 / 2e-12 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030964 [exp] 79 / 1e-19 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1) Lus10008107 [exp] 76 / 3e-18 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1) Lus10023675 [exp] 75 / 9e-18 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10030965 [exp] 74 / 1e-17 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10011068 [exp] 74 / 1e-17 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1) Lus10030565 [exp] 73 / 5e-17 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1) Lus10022826 [exp] 72 / 1e-16 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1) Lus10013145 [exp] 71 / 2e-16 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1) Lus10011895 [exp] 71 / 3e-16 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1) Lus10011069 [exp] 69 / 9e-16 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [poplar] [flax] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Potri.010G008300.1 pacid=42797893 polypeptide=Potri.010G008300.1.p locus=Potri.010G008300 ID=Potri.010G008300.1.v4.1 annot-version=v4.1 ATGCCAGCCCCATATCAGGTGGGTTATCATGTGGTGTTTCTCCTGGTATTCAGCTTCTCCAGGATGGTTCTTTCAGATGACGTGCATGCAAGCATCAAGA ACAGATTAGGCAATGGGGAAAACTTGAGCATACATTGTCAGTCGAAAGATGATGATCTTGGCCAGCAGGACATAGCCGATGGAAGTGAATTTGGTTGGGA CTTCTCAGTCAATGCATGGGGAACTACTCTATTTTATTGTGATATGGAATGGGAAAATGCTAGGAGATCCCATTTTGATGCATACTCGTTTTCAAGGGAT CACACAAGATGCGAGACTCAATGCTCGTGGCTAATATCAAAAGAAGGTATGTATGGGATGAATGGACAGACTGGATTTTGGGAATTCATGTATGATTGGC CAAACTGA
AA sequence Show only first row Show all	>Potri.010G008300.1 pacid=42797893 polypeptide=Potri.010G008300.1.p locus=Potri.010G008300 ID=Potri.010G008300.1.v4.1 annot-version=v4.1 MPAPYQVGYHVVFLLVFSFSRMVLSDDVHASIKNRLGNGENLSIHCQSKDDDLGQQDIADGSEFGWDFSVNAWGTTLFYCDMEWENARRSHFDAYSFSRD HTRCETQCSWLISKEGMYGMNGQTGFWEFMYDWPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G17080			Plant self-incompatibility pro...		Potri.010G008300 [exp]	0	1
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Potri.019G071200 [exp]	4.47	0.7730	CYP749A2
AT1G57775			Protein of unknown function (D...		Potri.004G110951 [exp]	7.34	0.7549
AT1G26870	NAC	FEZ, ANAC009	FEZ, Arabidopsis NAC domain co...		Potri.017G082000 [exp]	8.12	0.7987
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Potri.014G159700 [exp]	10.24	0.7914
AT4G22530			S-adenosyl-L-methionine-depend...		Potri.007G101800 [exp]	13.00	0.7666
AT2G35880			TPX2 (targeting protein for Xk...		Potri.001G140400 [exp]	103.48	0.7285
AT5G53050			alpha/beta-Hydrolases superfam...		Potri.015G011300 [exp]	139.73	0.6741
AT4G22165			F-box family protein with a do...		Potri.004G137700 [exp]	159.47	0.6674

Compare expression of checked genes

Potri.010G008300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.