Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15910 83 / 6e-22 ATDI21 drought-induced 21 (.1) AT1G02820 66 / 2e-15 Late embryogenesis abundant 3 (LEA3) family protein (.1) AT4G02380 60 / 4e-13 SAG21, ATLEA5 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) AT3G53770 45 / 7e-07 late embryogenesis abundant 3 (LEA3) family protein (.1), late embryogenesis abundant 3 (LEA3) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G203500 [exp] 50 / 3e-09 AT4G02380 74 / 1e-18 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Potri.014G127700 [exp] 43 / 1e-06 AT4G02380 79 / 1e-20 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006508 [exp] 74 / 1e-18 AT4G15910 73 / 2e-18 drought-induced 21 (.1) Lus10037497 [exp] 60 / 6e-13 AT4G15910 73 / 5e-18 drought-induced 21 (.1) Lus10027986 [exp] 50 / 2e-09 AT1G02820 78 / 3e-20 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10008170 [exp] 49 / 7e-09 AT4G02380 83 / 3e-22 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2) Lus10008169 [exp] 44 / 5e-07 AT1G02820 66 / 6e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10027987 [exp] 44 / 1e-06 AT1G02820 67 / 5e-16 Late embryogenesis abundant 3 (LEA3) family protein (.1) Lus10042672 [exp] 39 / 8e-05 AT4G02380 63 / 2e-14 Arabidopsis thaliana late embryogenensis abundant like 5, senescence-associated gene 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03242 [poplar] [flax] LEA_3 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.010G012100.1 pacid=42799248 polypeptide=Potri.010G012100.1.p locus=Potri.010G012100 ID=Potri.010G012100.1.v4.1 annot-version=v4.1 ATGGCTCGCTCTCTCCCAAACGCTAAGCTTCTTGTCGCTTCTCTTGCTGATGGTCTTTCCCTCTCTGTTTTCCGGAGAGGTTACGCGGCTGCTGCACCGA TCAGTGCTGCTGTAACAGCGAGCTTCGGTAGGGGTGGGTCAAGGACCAGTGCTATGACAGGGAAAATGGAAGATGGGGCGGTGGCCAAAGAAGATTCTGA GGCCTACTCTGCATGGGCTCCTGATCCAGTTACTGGGTATTACAGGCCTGCTAATTATGTAGCAGAGATTGATCCAGCTGAACTTAGGGAAATGGTGTTG AGCCATAGGGTTAGGCCACAGTAG
AA sequence Show only first row Show all	>Potri.010G012100.1 pacid=42799248 polypeptide=Potri.010G012100.1.p locus=Potri.010G012100 ID=Potri.010G012100.1.v4.1 annot-version=v4.1 MARSLPNAKLLVASLADGLSLSVFRRGYAAAAPISAAVTASFGRGGSRTSAMTGKMEDGAVAKEDSEAYSAWAPDPVTGYYRPANYVAEIDPAELREMVL SHRVRPQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15910		ATDI21	drought-induced 21 (.1)		Potri.010G012100 [exp]	0	1
AT1G69120	MADS	AGL7, AP1	APETALA1, AGAMOUS-like 7, K-bo...		Potri.010G154100 [exp]	9.74	0.8722	Pt-AGL8.2
AT2G28690			Protein of unknown function (D...		Potri.018G024900 [exp]	10.58	0.8645
AT5G54650		ATFH5, Fh5	FORMIN HOMOLOGY 5, formin homo...		Potri.007G119900 [exp]	13.41	0.8713
AT5G51890			Peroxidase superfamily protein...		Potri.015G138300 [exp]	15.29	0.8613
AT3G56850	bZIP	DPBF3, AREB3	ABA-responsive element binding...		Potri.001G220700 [exp]	23.06	0.8352
					Potri.010G199150 [exp]	24.97	0.8607
					Potri.013G066750 [exp]	30.16	0.8509
					Potri.009G071750 [exp]	30.57	0.8543
AT4G33870			Peroxidase superfamily protein...		Potri.001G182400 [exp]	32.24	0.8574
AT5G24270		ATSOS3, CBL4, S...	CALCINEURIN B-LIKE PROTEIN 4, ...		Potri.015G013200 [exp]	32.31	0.8519

Compare expression of checked genes

Potri.010G012100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.