Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL22.5
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05560 170 / 6e-56 Ribosomal L22e protein family (.1.2.3) AT5G27770 145 / 3e-46 Ribosomal L22e protein family (.1) AT1G02830 121 / 1e-36 Ribosomal L22e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G024400 [exp] 177 / 1e-58 AT3G05560 174 / 9e-58 Ribosomal L22e protein family (.1.2.3) Potri.013G015300 [exp] 176 / 3e-58 AT3G05560 172 / 1e-56 Ribosomal L22e protein family (.1.2.3) Potri.002G204100 [exp] 175 / 7e-58 AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) Potri.014G128800 [exp] 175 / 8e-58 AT3G05560 173 / 2e-57 Ribosomal L22e protein family (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037498 [exp] 172 / 9e-57 AT3G05560 197 / 1e-66 Ribosomal L22e protein family (.1.2.3) Lus10006509 [exp] 171 / 3e-56 AT3G05560 196 / 3e-66 Ribosomal L22e protein family (.1.2.3) Lus10026555 [exp] 100 / 1e-28 AT3G05560 118 / 3e-36 Ribosomal L22e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01776 [poplar] [flax] Ribosomal_L22e Ribosomal L22e protein family
Representative CDS sequence Show only first row Show all	>Potri.010G012700.2 pacid=42798521 polypeptide=Potri.010G012700.2.p locus=Potri.010G012700 ID=Potri.010G012700.2.v4.1 annot-version=v4.1 ATGAGCAAGGGAGCAGCAGCTGTAGGCGGGGCCAAGGGAAAGAAGAAAGGAGCAACAACGTTCACGATCGATTGTGCAAAGCCAGTGGAAGATAAAATTA TGGACATTGCCTCACTGGAAAAGTTCCTCCAAGAACGCATTAAAGTCGGCGGCAAACCCGGAGCTCTCGGTGATTCCGTTACAGTCACCCGTGACAAGTC CAAGATCACCGTCACCTGTGACTCTAGCTTCTCCAAACGTTATTTGAAGTATTTGACAAAGAAGTACTTGAAGAAGCATAACGTGAGAGATTGGCTTAGG GTTATTTCATCGAATAAGGACAGGAATGCTTATGAGCTGAGATACTTTAACATTGCTGAGAACGAAGGCGAGGAAGAAGATTGA
AA sequence Show only first row Show all	>Potri.010G012700.2 pacid=42798521 polypeptide=Potri.010G012700.2.p locus=Potri.010G012700 ID=Potri.010G012700.2.v4.1 annot-version=v4.1 MSKGAAAVGGAKGKKKGATTFTIDCAKPVEDKIMDIASLEKFLQERIKVGGKPGALGDSVTVTRDKSKITVTCDSSFSKRYLKYLTKKYLKKHNVRDWLR VISSNKDRNAYELRYFNIAENEGEEED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05560			Ribosomal L22e protein family ...		Potri.010G012700 [exp]	0	1	RPL22.5
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.015G141900 [exp]	1.73	0.9655
AT2G39390			Ribosomal L29 family protein ...		Potri.006G214200 [exp]	2.82	0.9645
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Potri.006G136500 [exp]	6.70	0.9303	TIF3.2
AT3G12390			Nascent polypeptide-associated...		Potri.003G190800 [exp]	6.92	0.9515
AT5G16950			unknown protein		Potri.001G082000 [exp]	11.04	0.8896
AT5G15200			Ribosomal protein S4 (.1.2)		Potri.006G209801 [exp]	11.66	0.9299
AT2G35790			unknown protein		Potri.010G219000 [exp]	12.64	0.9287
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Potri.007G040100 [exp]	14.14	0.9179
AT3G02560			Ribosomal protein S7e family p...		Potri.016G100400 [exp]	14.14	0.9499
AT2G16595			Translocon-associated protein ...		Potri.004G168500 [exp]	14.49	0.9396

Compare expression of checked genes

Potri.010G012700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.