Pt-TCTP.2 (Potri.010G013400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TCTP.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16640 217 / 4e-73 TCTP translationally controlled tumor protein (.1)
AT3G05540 212 / 3e-71 Methionine sulfoxide reductase (MSS4-like) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G221200 251 / 2e-86 AT3G16640 228 / 2e-77 translationally controlled tumor protein (.1)
Potri.005G024800 230 / 2e-78 AT3G16640 284 / 8e-100 translationally controlled tumor protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002877 230 / 4e-78 AT3G16640 256 / 2e-88 translationally controlled tumor protein (.1)
Lus10033959 230 / 4e-78 AT3G16640 256 / 2e-88 translationally controlled tumor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0080 Beta-tent PF00838 TCTP Translationally controlled tumour protein
Representative CDS sequence
>Potri.010G013400.1 pacid=42798698 polypeptide=Potri.010G013400.1.p locus=Potri.010G013400 ID=Potri.010G013400.1.v4.1 annot-version=v4.1
ATGTTGGTCTATCAAGATCTTCTCTCTGGTGATGAGCTTCTCTCGGATTCGTTCCCATACAAGGAGATTGAGAATGGGATACTGTGGGAAGTTGAAGGAA
AGTGGGTTGTTCAAGGAGCCGTTGATGTAGACATTGGTGCAAATCCTTCAGCTGAAGGAGGTGATGAGGATGAGGGTGTTGATGACCAAGCTGCCAAGGT
TGTTGACATCGTTGACACATTTAGGCTCCAGGAGCAACCTCCATTTGACAAGAAGCAGTTTCTTACACAGATTAAGAAATTTATCAAGAATCTGTCGGAG
AAACTTGATGAGGACCAGAAGGAACATTTTAGAAAGAACATTGAGGGAGCAACCAAGTTCTTGCTTTCAAAAATCAAGGACTTGCAATTCTTTGTGGGGG
AGAGCATGCATGATGATGGTTGCTTGGTCTTTGCTTATTACAAAGAAGGTGCTACCGATCCAACATTCTTGTACTTTGCCCCTTCTTTGAAGGAGGTCAA
GTGCTGA
AA sequence
>Potri.010G013400.1 pacid=42798698 polypeptide=Potri.010G013400.1.p locus=Potri.010G013400 ID=Potri.010G013400.1.v4.1 annot-version=v4.1
MLVYQDLLSGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSAEGGDEDEGVDDQAAKVVDIVDTFRLQEQPPFDKKQFLTQIKKFIKNLSE
KLDEDQKEHFRKNIEGATKFLLSKIKDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYFAPSLKEVKC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G16640 TCTP translationally controlled tum... Potri.010G013400 0 1 Pt-TCTP.2
AT3G05700 Drought-responsive family prot... Potri.013G011200 1.41 0.9138
AT1G02870 unknown protein Potri.014G130400 2.00 0.8861
AT1G45976 SBP1 S-ribonuclease binding protein... Potri.002G124700 3.74 0.8557
AT5G46030 unknown protein Potri.011G097300 4.47 0.8685
AT1G02780 EMB2386 embryo defective 2386, Ribosom... Potri.004G078000 4.69 0.8410 Pt-RPL19.3
AT2G04410 RPM1-interacting protein 4 (RI... Potri.014G168900 6.92 0.8537
AT5G64130 cAMP-regulated phosphoprotein ... Potri.017G102700 6.92 0.8389
AT5G06240 EMB2735 embryo defective 2735 (.1) Potri.016G074700 7.34 0.8583
AT4G30330 Small nuclear ribonucleoprotei... Potri.018G096200 8.66 0.8035
AT1G12520 ATCCS, CCS1 copper chaperone for SOD1 (.1.... Potri.001G113800 8.71 0.8733

Potri.010G013400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.