Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02510 54 / 2e-09 TOC86, TOC160, PPI2, ATTOC159, TOC159 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) AT5G20300 45 / 3e-06 Toc90 translocon at the outer envelope membrane of chloroplasts 90, Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2), Avirulence induced gene (AIG1) family protein (.3) AT4G15810 42 / 6e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G16640 0 / 1 ATTOC132, TOC132 multimeric translocon complex in the outer envelope membrane 132 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G225000 [exp] 90 / 1e-21 AT4G02510 790 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.010G014300 [exp] 89 / 3e-21 AT4G02510 812 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.009G131300 [exp] 47 / 7e-07 AT3G16620 1111 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1) Potri.018G123300 [exp] 46 / 2e-06 AT5G20300 796 / 0.0 translocon at the outer envelope membrane of chloroplasts 90, Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2), Avirulence induced gene (AIG1) family protein (.3) Potri.006G063500 [exp] 45 / 5e-06 AT5G20300 865 / 0.0 translocon at the outer envelope membrane of chloroplasts 90, Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2), Avirulence induced gene (AIG1) family protein (.3) Potri.009G131200 [exp] 40 / 0.0002 AT3G16620 1129 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1) Potri.008G224900 [exp] 0 / 1 AT4G02510 847 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Potri.004G171600 [exp] 0 / 1 AT3G16620 1128 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043414 [exp] 60 / 3e-11 AT4G02510 387 / 2e-119 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Lus10006048 [exp] 59 / 4e-11 AT4G02510 1178 / 0.0 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Lus10028706 [exp] 58 / 1e-10 AT4G02510 548 / 3e-175 TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 86, TRANSLOCON AT THE OUTER ENVELOPE MEMBRANE OF CHLOROPLASTS 160, PLASTID PROTEIN IMPORT 2, translocon at the outer envelope membrane of chloroplasts 159 (.1) Lus10006471 [exp] 39 / 0.0006 AT5G20300 754 / 0.0 translocon at the outer envelope membrane of chloroplasts 90, Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2), Avirulence induced gene (AIG1) family protein (.3) Lus10027712 [exp] 39 / 0.0008 AT5G20300 744 / 0.0 translocon at the outer envelope membrane of chloroplasts 90, Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2), Avirulence induced gene (AIG1) family protein (.3) Lus10034170 [exp] 0 / 1 AT2G16640 374 / 1e-111 multimeric translocon complex in the outer envelope membrane 132 (.1) Lus10027835 [exp] 0 / 1 AT3G16620 645 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1) Lus10005063 [exp] 0 / 1 AT3G16620 1204 / 0.0 ARABIDOPSIS THALIANA TRANSLOCON OUTER COMPLEX PROTEIN 120, translocon outer complex protein 120 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G014401.1 pacid=42799210 polypeptide=Potri.010G014401.1.p locus=Potri.010G014401 ID=Potri.010G014401.1.v4.1 annot-version=v4.1 ATGATTCTGAGTTTAACTCCATCTACGGTTCCAACAATTTCCTTCACCGTAGTTGTGGCAGGTTCAAAAGCATTGATCTCTACTTTCTTCTCACCGAAAA CAGAATTAACGGTTGCACTCTTTCCCACTCCAGTTTTCCCAAGAACCAAAATGTTCAAAGAGAAGTCTAAATCATCTTTTCCCTCAGCTTCAAGCTGCGT GGCCATTTTCTTGGCATTTTCAAGGCTAAAACTCTTGATTAACAACCAGCCTGTGCAACACCTGTGCAACTATGGAATCTTCAGGGGATTGTCCGAGTCT CTGGACAATCCTCAAGAACTTCACTGCCATTTTCTGTATCTTCTCAATCACCATATCTTCTTCATTCAAATCATTCTTCACTATATCCACGACCGTTTCA GATAG
AA sequence Show only first row Show all	>Potri.010G014401.1 pacid=42799210 polypeptide=Potri.010G014401.1.p locus=Potri.010G014401 ID=Potri.010G014401.1.v4.1 annot-version=v4.1 MILSLTPSTVPTISFTVVVAGSKALISTFFSPKTELTVALFPTPVFPRTKMFKEKSKSSFPSASSCVAIFLAFSRLKLLINNQPVQHLCNYGIFRGLSES LDNPQELHCHFLYLLNHHIFFIQIILHYIHDRFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02510		TOC86, TOC160, ...	TRANSLOCON AT THE OUTER ENVELO...		Potri.010G014401 [exp]	0	1
AT1G20670			DNA-binding bromodomain-contai...		Potri.019G132601 [exp]	1.00	0.9310
AT2G40470	AS2	ASL11, LBD15	ASYMMETRIC LEAVES2-LIKE 11, LO...		Potri.013G081200 [exp]	4.24	0.8870
AT2G37710		RLK	receptor lectin kinase (.1)		Potri.009G036450 [exp]	5.47	0.8703
AT1G26660			Prefoldin chaperone subunit fa...		Potri.010G163600 [exp]	5.91	0.8629
AT5G24450			Transcription factor IIIC, sub...		Potri.017G007200 [exp]	7.34	0.8473
					Potri.005G162201 [exp]	7.48	0.8681
AT1G28590			GDSL-like Lipase/Acylhydrolase...		Potri.004G054300 [exp]	12.12	0.8408
					Potri.006G267450 [exp]	12.32	0.8369
AT1G70140		ATFH8	formin 8 (.1)		Potri.008G192900 [exp]	12.72	0.8331
AT5G60740		ABCG28	ATP-binding cassette G28, ABC ...		Potri.003G169000 [exp]	14.28	0.7634

Compare expression of checked genes

Potri.010G014401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.