Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27290 131 / 3e-36 S-locus lectin protein kinase family protein (.1) AT1G11300 109 / 2e-28 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1) AT4G21390 105 / 3e-27 B120 S-locus lectin protein kinase family protein (.1) AT1G11350 102 / 3e-26 SD1-13, RKS2, CBRLK1 CALMODULIN-BINDING RECEPTOR-LIKE PROTEIN KINASE, S-domain-1 13 (.1) AT1G61390 102 / 4e-26 S-locus lectin protein kinase family protein (.1.2) AT1G11340 102 / 4e-26 S-locus lectin protein kinase family protein (.1) AT1G61610 101 / 1e-25 S-locus lectin protein kinase family protein (.1) AT1G61380 100 / 1e-25 SD1-29 S-domain-1 29 (.1) AT1G11280 97 / 6e-24 S-locus lectin protein kinase family protein (.1.2.3.4) AT1G11410 96 / 1e-23 S-locus lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G017800 [exp] 273 / 3e-92 AT4G27290 462 / 1e-156 S-locus lectin protein kinase family protein (.1) Potri.010G017100 [exp] 275 / 4e-89 AT4G27290 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G017450 [exp] 272 / 7e-88 AT4G27290 847 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G020200 [exp] 265 / 8e-88 AT4G27290 517 / 3e-176 S-locus lectin protein kinase family protein (.1) Potri.010G018600 [exp] 271 / 2e-87 AT4G27290 853 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G015800 [exp] 269 / 1e-86 AT4G27290 844 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G018300 [exp] 263 / 3e-84 AT4G27290 841 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G018400 [exp] 263 / 3e-84 AT4G27290 847 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.010G025601 [exp] 236 / 5e-80 AT4G27290 234 / 2e-72 S-locus lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007611 [exp] 125 / 4e-34 AT1G11340 751 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038557 [exp] 124 / 1e-33 AT4G27290 803 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014808 [exp] 122 / 7e-33 AT4G27290 588 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038552 [exp] 120 / 4e-32 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014810 [exp] 119 / 8e-32 AT4G27290 692 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 119 / 8e-32 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037865 [exp] 116 / 7e-31 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038554 [exp] 114 / 3e-30 AT4G27290 776 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038556 [exp] 114 / 4e-30 AT4G21380 769 / 0.0 receptor kinase 3 (.1) Lus10014723 [exp] 110 / 4e-30 AT1G11340 255 / 7e-79 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01453 [poplar] [flax] B_lectin D-mannose binding lectin
Representative CDS sequence Show only first row Show all	>Potri.010G015533.1 pacid=42798682 polypeptide=Potri.010G015533.1.p locus=Potri.010G015533 ID=Potri.010G015533.1.v4.1 annot-version=v4.1 ATGGATTACATCCCCATGCTTGTTTTCTGCTTCATTTCATTTCTGATTGTAAGAACAACCACACCTACTGACACCATAAACACAGCCCAGTTCATTGGAG ATGGAGACACTATAGTTTCATCTGGCGGGACCTATGAATTAGGATTTTTCAGCCCCGGGAAATCCAAAAGCCGATACTTGGGGATATGGTATGGCAAAAT ATCTGTCCAGACAGCAGTTTGGGTTGCCAACAGAGAAACTCCACTTAACGATTCATCAGGACTTGTAAGGCTTACCAACCAAGGAGTTCTTGTTCTTCTC AATCGTAGTGGAAGCATCATTTGGTCTTCCAACACATCAACACCTGCTAGGAATCCAGTTGCGCAGCTTTTGGATACAGGAAACCTTGTTGTGAAAGAGG AGGGTGATAATAACATGGAAAATTCCTTGTAG
AA sequence Show only first row Show all	>Potri.010G015533.1 pacid=42798682 polypeptide=Potri.010G015533.1.p locus=Potri.010G015533 ID=Potri.010G015533.1.v4.1 annot-version=v4.1 MDYIPMLVFCFISFLIVRTTTPTDTINTAQFIGDGDTIVSSGGTYELGFFSPGKSKSRYLGIWYGKISVQTAVWVANRETPLNDSSGLVRLTNQGVLVLL NRSGSIIWSSNTSTPARNPVAQLLDTGNLVVKEEGDNNMENSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27290			S-locus lectin protein kinase ...		Potri.010G015533 [exp]	0	1
AT1G72890			Disease resistance protein (TI...		Potri.011G013225 [exp]	4.89	0.7216
AT1G54540			Late embryogenesis abundant (L...		Potri.004G067100 [exp]	13.78	0.6738
AT2G17790		ZIP3, VPS35A	ZIG suppressor 3, VPS35 homolo...		Potri.005G110600 [exp]	18.70	0.6923
					Potri.008G027800 [exp]	34.75	0.6698
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	39.11	0.6657
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.005G222550 [exp]	60.89	0.6229
AT1G70750			Protein of unknown function, D...		Potri.010G109900 [exp]	62.12	0.6411
AT1G61260			Protein of unknown function (D...		Potri.001G406600 [exp]	72.41	0.5932
AT5G50011		CPuORF37	conserved peptide upstream ope...		Potri.005G158000 [exp]	140.99	0.5904

Compare expression of checked genes

Potri.010G015533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.