Potri.010G022700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 219 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 203 / 1e-61 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 160 / 4e-45 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 155 / 4e-43 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 148 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 146 / 1e-39 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 138 / 7e-37 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 129 / 2e-33 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 129 / 2e-33 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 127 / 7e-33 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G013100 448 / 2e-157 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 436 / 7e-153 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 427 / 5e-149 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 422 / 4e-147 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 413 / 9e-144 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 390 / 5e-135 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 317 / 3e-106 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 300 / 2e-99 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 285 / 2e-93 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002883 246 / 5e-78 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 236 / 1e-74 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 233 / 2e-73 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 228 / 2e-71 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 223 / 1e-69 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 174 / 1e-50 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 150 / 6e-43 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 150 / 9e-43 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 150 / 1e-42 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 140 / 9e-39 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.010G022700.1 pacid=42796834 polypeptide=Potri.010G022700.1.p locus=Potri.010G022700 ID=Potri.010G022700.1.v4.1 annot-version=v4.1
ATGTTAGGGGGTGCTGTAAGAGCTTCAACAAATCATAGACAACACTATTTTCTCGAAAACCCTTCATTATTATCATCTCCCAGACACATCTCATCAAGCA
AAAGCAATGGAAATGCAAATCAACACTCATTTACTGTTTCTTACCTCGTTAACAAATGTGGGTTTTCACTAAAATCTGCATTAGAAGCTTCTAAACGTGT
CCATTATGAAACTCCACATAAACCCGATTCTTTACTTAGCTTCTTCAAGGACCATGGCTTCTCAGAGAACCAAACTTTAAAACTTACCAGAAAATGCCCT
GAACTGCTTTTGTACAATCCTGACAAAACCCTTTTACCCAAACTTGAGTTTTTGTATTCTAAAGGTGTTTCAACCGCTGATGTTGCTAAAATCATATCCT
TCTACCCTTGGATTTTGAGATGCAGCTTAGAAAACCAGTTAGTCCCTACTTTTGATTTTTTGAAAAATTGGTTCCCGAATGATACCATTGTTCAAGTATT
CAAAAGTACTCCTCTTGTTCTTCAACTTAATCCTGTAACTGTGAAATATATTTCCCAGATTTTGCGAGATAATGGAGTGCCTGACAAGAATATTGTTATG
CTAGTTCGTAGCCACCCTAAAACATTGTTGTTGAGTCCAAAGAAATTTAACATGGTGCTGTGCAAAGTGAGGAAAATGGGATTAGATCCTTGCAAGAGTC
AATTTGTCGTTGCGATCCTAGCATTGACGTCCATGAGCAGATCCACATGGGAAAAGAAACTTGATGTATATAGGAGATGGGGTTTGTCCCATGAAGAGAT
TCTTGCAGCATTTGCAAAGTCTCCGTGGTTTATGACCCTATCTGAAGAGAAGGTTGTGGCAGTGATGGATCTTTTTGTCAACAAATTGGGCTGGGAATCT
TCTTTTATTGCCAAAAACCCAACACTTGTCTCGTATAGCTTGGAAAAGAGGCTCACTCCAAGGGCTTCGGTTTTGCAATTTCTAGTGTCTCAAGGTTTGA
TTGAGAAGAGTTTCAGAAGCACTACATTCTTCATTGCATCTGAAAATAAGTTCCTGCAGCAGTTCATAAATCAGCGTGCTGAATCGACCCAGATATTGAA
ACTGTACCAGGAGAAATTGAATCTTTCAAGATAA
AA sequence
>Potri.010G022700.1 pacid=42796834 polypeptide=Potri.010G022700.1.p locus=Potri.010G022700 ID=Potri.010G022700.1.v4.1 annot-version=v4.1
MLGGAVRASTNHRQHYFLENPSLLSSPRHISSSKSNGNANQHSFTVSYLVNKCGFSLKSALEASKRVHYETPHKPDSLLSFFKDHGFSENQTLKLTRKCP
ELLLYNPDKTLLPKLEFLYSKGVSTADVAKIISFYPWILRCSLENQLVPTFDFLKNWFPNDTIVQVFKSTPLVLQLNPVTVKYISQILRDNGVPDKNIVM
LVRSHPKTLLLSPKKFNMVLCKVRKMGLDPCKSQFVVAILALTSMSRSTWEKKLDVYRRWGLSHEEILAAFAKSPWFMTLSEEKVVAVMDLFVNKLGWES
SFIAKNPTLVSYSLEKRLTPRASVLQFLVSQGLIEKSFRSTTFFIASENKFLQQFINQRAESTQILKLYQEKLNLSR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.010G022700 0 1
AT5G27730 Protein of unknown function (D... Potri.013G016900 2.64 0.9058
AT2G29760 OTP81 ORGANELLE TRANSCRIPT PROCESSIN... Potri.008G106500 2.82 0.8981
AT5G49760 Leucine-rich repeat protein ki... Potri.004G231500 3.46 0.9031
AT5G08520 MYB Duplicated homeodomain-like su... Potri.007G076200 7.93 0.8912
AT3G53170 Tetratricopeptide repeat (TPR)... Potri.009G058300 12.32 0.8862
AT3G22470 Pentatricopeptide repeat (PPR)... Potri.013G034400 18.33 0.8760
AT4G35440 CLCE, ATCLC-E, ... chloride channel E (.1.2) Potri.004G209900 18.70 0.8803
AT2G32230 PRORP1 proteinaceous RNase P 1 (.1) Potri.006G160300 19.49 0.8948
AT1G64355 unknown protein Potri.003G138500 23.49 0.8930
AT1G03670 ankyrin repeat family protein ... Potri.018G078450 26.51 0.8769

Potri.010G022700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.