Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL14.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46160 200 / 2e-66 Ribosomal protein L14p/L23e family protein (.1.2) AT1G17560 149 / 5e-46 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1) ATCG00780 97 / 1e-26 ATCG00780.1, RPL14 ribosomal protein L14 (.1) AT3G04400 42 / 4e-05 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) AT2G33370 41 / 5e-05 Ribosomal protein L14p/L23e family protein (.1) AT1G04480 41 / 5e-05 Ribosomal protein L14p/L23e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G096525 [exp] 66 / 2e-14 AT5G46160 62 / 5e-13 Ribosomal protein L14p/L23e family protein (.1.2) Potri.008G171200 [exp] 42 / 5e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G066400 [exp] 42 / 5e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.002G257500 [exp] 42 / 5e-05 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038513 [exp] 220 / 3e-74 AT5G46160 249 / 6e-86 Ribosomal protein L14p/L23e family protein (.1.2) Lus10023296 [exp] 206 / 1e-67 AT5G46160 232 / 1e-77 Ribosomal protein L14p/L23e family protein (.1.2) Lus10011773 [exp] 43 / 3e-05 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10022881 [exp] 43 / 3e-05 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10012464 [exp] 42 / 4e-05 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10020499 [exp] 42 / 4e-05 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1) Lus10024943 [exp] 42 / 5e-05 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10023730 [exp] 42 / 6e-05 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) Lus10042695 [exp] 42 / 6e-05 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00238 [poplar] [flax] Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence Show only first row Show all	>Potri.010G022800.1 pacid=42797910 polypeptide=Potri.010G022800.1.p locus=Potri.010G022800 ID=Potri.010G022800.1.v4.1 annot-version=v4.1 ATGGCTGCCAGTTTCGTTTCTAAATGCTCTCGTGGGGACTGTTCATTGTTCAGGGGCCTTGGTACCAATGTTTCTAATTTACTGAGCACAGCCACTCGAA TGACATGGAGCAATTTCTTATCTCAGCATCAAAGAACTTTCATACAGATGAGGACTGTTCTCAAGGTTGTGGATAACTCAGGAGCAAAAAAGGTGATGTG CATACAACCTTTGAAGGGGAGGAAAGGGGCAAGGTTGGGGGACACCATCATTGCCTCTGTAAAGGAAGCTGCTCCAAATGGAAAAGTGAAGAAAGGCGCG GTTGTGCGAGGTGTAGTAGTGCGTGCTGCAATGCAGCGTGGCCGTTGTGATGGGAGTGAGGTCAAGTTCGATGATAATGCAGTAGTGATTATTGACAAGC AAGGCCAGCCAGTGGGGAGCAGGGTTTTTGGGCCAGTTCCACATGAGCTGAGGAAAAAAAAGCATGTCAAGATCCTTGCTCTGGCAGAGCATATTGCCTG A
AA sequence Show only first row Show all	>Potri.010G022800.1 pacid=42797910 polypeptide=Potri.010G022800.1.p locus=Potri.010G022800 ID=Potri.010G022800.1.v4.1 annot-version=v4.1 MAASFVSKCSRGDCSLFRGLGTNVSNLLSTATRMTWSNFLSQHQRTFIQMRTVLKVVDNSGAKKVMCIQPLKGRKGARLGDTIIASVKEAAPNGKVKKGA VVRGVVVRAAMQRGRCDGSEVKFDDNAVVIIDKQGQPVGSRVFGPVPHELRKKKHVKILALAEHIA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46160			Ribosomal protein L14p/L23e fa...		Potri.010G022800 [exp]	0	1	RPL14.1
AT1G08220			unknown protein		Potri.009G002000 [exp]	1.00	0.8514
AT3G57610		ADSS, ATPURA	adenylosuccinate synthase (.1)		Potri.016G087900 [exp]	2.00	0.8233
AT2G34480			Ribosomal protein L18ae/LX fam...		Potri.011G072400 [exp]	2.82	0.8366	RPL18.5
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Potri.010G084800 [exp]	3.87	0.8172	PBD2.2
AT1G27390		TOM20-2	translocase outer membrane 20-...		Potri.001G054900 [exp]	3.87	0.8268	Pt-TOM20.1
AT5G06360			Ribosomal protein S8e family p...		Potri.006G203400 [exp]	5.29	0.7973
					Potri.018G024000 [exp]	6.24	0.7264
AT2G01640			unknown protein		Potri.009G097000 [exp]	6.63	0.7828
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Potri.019G121400 [exp]	7.74	0.7879
AT5G15750			Alpha-L RNA-binding motif/Ribo...		Potri.004G113600 [exp]	8.48	0.7948

Compare expression of checked genes

Potri.010G022800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.