Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21420 210 / 7e-68 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 130 / 4e-37 ATSRG1, SRG1 senescence-related gene 1 (.1) AT4G25300 125 / 3e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G17010 122 / 5e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 120 / 3e-33 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G78550 114 / 8e-31 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 112 / 4e-30 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 103 / 2e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G05600 100 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G20550 100 / 2e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G023600 [exp] 350 / 6e-123 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G217200 [exp] 213 / 1e-69 AT3G21420 236 / 6e-76 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G382400 [exp] 138 / 7e-40 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G381700 [exp] 131 / 2e-37 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1) Potri.001G355100 [exp] 125 / 5e-35 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.010G200900 [exp] 124 / 1e-34 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G201000 [exp] 122 / 8e-34 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G022800 [exp] 118 / 2e-32 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1) Potri.016G117100 [exp] 112 / 7e-30 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006518 [exp] 247 / 4e-82 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015252 [exp] 125 / 4e-35 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10030995 [exp] 119 / 2e-32 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10011979 [exp] 117 / 6e-32 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10004582 [exp] 114 / 1e-31 AT1G17020 231 / 2e-74 senescence-related gene 1 (.1) Lus10030934 [exp] 116 / 2e-31 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1) Lus10011980 [exp] 114 / 1e-30 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10040112 [exp] 113 / 2e-30 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10030941 [exp] 112 / 2e-30 AT1G17010 258 / 2e-84 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011981 [exp] 111 / 1e-29 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.010G023550.1 pacid=42797482 polypeptide=Potri.010G023550.1.p locus=Potri.010G023550 ID=Potri.010G023550.1.v4.1 annot-version=v4.1 ATGGCTCCTGTTCCCATTTCTCCAATTAACGTTGGTCATATTGATGATGTTCAAGAACTGAGAAAGGCTAGGCCAGCAACAATCCCTGAAAGATTTGTTA GGGACATGACAGAAAGACCAACACTAGCCACAGCTCTACAGCCTCCTGATACCGTTCCCATCATTGATTTCTCAAGGCTTGTTAAAGGCAATAAAGATGA ATACAAGAGTGAAATGTTGCAGCTGACAAGAGCTTGCGAGGAGTGGGGTTTTTTTCAGGTGATTAACCACGGGATTGATCTGAGTTTGCTGGAGAGTATA GAGAAGGTTGCCAGGGATTTCTTCGTGCTGCCTTTAGAGGAGAAGCAGAAGTATCCCATGTTGCCAGGGACTGTTCAGGGATATGGACAGGCCTTTGTGT TCTCTGAGGACCAAAAGCTGGACTGGTGCAACATGTTTGCTCTTGGGCTTGAGCCCCACTTTATAAGGGTCCCAAAACTATGGCCAGCAAAGCCACTCAA GTTCAGGTAA
AA sequence Show only first row Show all	>Potri.010G023550.1 pacid=42797482 polypeptide=Potri.010G023550.1.p locus=Potri.010G023550 ID=Potri.010G023550.1.v4.1 annot-version=v4.1 MAPVPISPINVGHIDDVQELRKARPATIPERFVRDMTERPTLATALQPPDTVPIIDFSRLVKGNKDEYKSEMLQLTRACEEWGFFQVINHGIDLSLLESI EKVARDFFVLPLEEKQKYPMLPGTVQGYGQAFVFSEDQKLDWCNMFALGLEPHFIRVPKLWPAKPLKFR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.010G023550 [exp]	0	1
AT3G21420		LBO1	LATERAL BRANCHING OXIDOREDUCTA...		Potri.010G023600 [exp]	1.00	0.9958
					Potri.006G189401 [exp]	1.41	0.9292
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Potri.004G019800 [exp]	2.44	0.8993
AT5G12930			unknown protein		Potri.003G207500 [exp]	5.09	0.8041
AT5G66815			unknown protein		Potri.014G034500 [exp]	6.32	0.8843
AT3G26932		DRB3	dsRNA-binding protein 3 (.1.2)		Potri.009G152900 [exp]	6.48	0.8009
AT4G24120		ATYSL1, YSL1	YELLOW STRIPE like 1 (.1)		Potri.001G082400 [exp]	6.92	0.8598
					Potri.003G056450 [exp]	7.48	0.8839
AT5G10530			Concanavalin A-like lectin pro...		Potri.003G094700 [exp]	9.21	0.7858
					Potri.019G005913 [exp]	9.48	0.8750

Compare expression of checked genes

Potri.010G023550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.