Potri.010G025000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15802 112 / 4e-34 AtHSBP Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G208100 119 / 9e-37 AT4G15802 123 / 3e-38 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Potri.014G131701 108 / 2e-32 AT4G15802 120 / 3e-37 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000501 53 / 2e-10 AT4G15802 53 / 2e-10 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06825 HSBP1 Heat shock factor binding protein 1
Representative CDS sequence
>Potri.010G025000.1 pacid=42799877 polypeptide=Potri.010G025000.1.p locus=Potri.010G025000 ID=Potri.010G025000.1.v4.1 annot-version=v4.1
ATGGATGGGCACGATGCAGATGATGCCAAAAAGAGCACTGCTGATATGACTGCTTTTGTGCAAAATTTGCTGCAGCAGATGCAATCCAGGTTCCAGACAA
TGTCTGACTCCATCGTTACAAAGATCGATGAAATGGGCAACAGGATAGATGAGTTGGAGCAGAGCATCAATGATCTCAGAACTGAAATGGGGGTAGAGGG
TTCCCCTTCTCCTTCTGTCCCTCCCAAGGTCAAGGAAGAACCCAAGCCAGGCAACGATTCTGCTTAA
AA sequence
>Potri.010G025000.1 pacid=42799877 polypeptide=Potri.010G025000.1.p locus=Potri.010G025000 ID=Potri.010G025000.1.v4.1 annot-version=v4.1
MDGHDADDAKKSTADMTAFVQNLLQQMQSRFQTMSDSIVTKIDEMGNRIDELEQSINDLRTEMGVEGSPSPSVPPKVKEEPKPGNDSA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G15802 AtHSBP Arabidopsis thaliana heat shoc... Potri.010G025000 0 1
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Potri.009G058600 2.00 0.8313 Pt-SMT.2
AT2G18910 hydroxyproline-rich glycoprote... Potri.006G166400 3.74 0.8282
AT4G34490 ATCAP1 cyclase associated protein 1 (... Potri.009G115500 5.47 0.8216 Pt-CAP1.2
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.018G030700 6.63 0.7945
AT1G09630 ATRAB-A2A, ATRA... ARABIDOPSIS RAB GTPASE A2A, RA... Potri.003G004100 10.95 0.8200
AT5G24400 PGL3, EMB2024 6-PHOSPHOGLUCONOLACTONASE 3, E... Potri.015G007200 11.61 0.7424
AT4G15800 RALFL33 ralf-like 33 (.1) Potri.013G017400 12.96 0.7621 Pt-RALFL23.3
AT4G29340 PRF4 profilin 4 (.1) Potri.018G057600 15.16 0.8200 PRO1.3
AT5G48485 DIR1 DEFECTIVE IN INDUCED RESISTANC... Potri.002G251000 17.14 0.7778
Potri.009G037500 17.60 0.7964

Potri.010G025000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.