Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02500 68 / 9e-15 ATXT2, XXT2 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) AT3G62720 61 / 3e-12 ATXT1, XXT1 XYG XYLOSYLTRANSFERASE 1, xylosyltransferase 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G025300 [exp] 66 / 7e-14 AT4G02500 775 / 0.0 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Potri.008G208000 [exp] 63 / 7e-13 AT4G02500 773 / 0.0 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Potri.012G068300 [exp] 41 / 3e-05 AT5G07720 755 / 0.0 Galactosyl transferase GMA12/MNN10 family protein (.1) Potri.010G025100 [exp] 40 / 9e-05 AT3G62720 674 / 0.0 XYG XYLOSYLTRANSFERASE 1, xylosyltransferase 1 (.1.2) Potri.015G061800 [exp] 39 / 0.0001 AT5G07720 730 / 0.0 Galactosyl transferase GMA12/MNN10 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037520 [exp] 68 / 3e-15 AT4G02500 449 / 3e-159 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Lus10037516 [exp] 68 / 9e-15 AT4G02500 786 / 0.0 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Lus10002870 [exp] 68 / 9e-15 AT4G02500 779 / 0.0 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Lus10037519 [exp] 68 / 1e-14 AT4G02500 786 / 0.0 XYG XYLOSYLTRANSFERASE 2, ARABIDOPSIS THALIANA UDP-XYLOSYLTRANSFERASE 2, UDP-xylosyltransferase 2 (.1) Lus10019076 [exp] 40 / 8e-05 AT5G07720 744 / 0.0 Galactosyl transferase GMA12/MNN10 family protein (.1) Lus10015721 [exp] 40 / 8e-05 AT5G07720 741 / 0.0 Galactosyl transferase GMA12/MNN10 family protein (.1) Lus10000563 [exp] 37 / 0.0008 AT5G07720 759 / 0.0 Galactosyl transferase GMA12/MNN10 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G025400.2 pacid=42797578 polypeptide=Potri.010G025400.2.p locus=Potri.010G025400 ID=Potri.010G025400.2.v4.1 annot-version=v4.1 ATGACTGATCATCACCTTCAGGATCTTGGTGGTCATAGTCGGCTGCTTGTGATTCACTTTTTGGTATGGAAGCTTCGTTGGAAGTTTGGAGATTATCCAG TGGAAAGGTGCTCAAAGCAGATGGACCAACAATCAAATTTGCAGGTTTATGGTTTACTAATAAATCTCTTGTCAGTTGGAGAATTCGGATTGAGAGCTGA GACTAGCAATCCACTTGGAGTGAAGGATGAGTGTGGCTTGCATCCCCCTGCATTAAGGATGCCAAGTTTGTACTCTTGGCATGCTGATTGA
AA sequence Show only first row Show all	>Potri.010G025400.2 pacid=42797578 polypeptide=Potri.010G025400.2.p locus=Potri.010G025400 ID=Potri.010G025400.2.v4.1 annot-version=v4.1 MTDHHLQDLGGHSRLLVIHFLVWKLRWKFGDYPVERCSKQMDQQSNLQVYGLLINLLSVGEFGLRAETSNPLGVKDECGLHPPALRMPSLYSWHAD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G02500		ATXT2, XXT2	XYG XYLOSYLTRANSFERASE 2, ARAB...		Potri.010G025400 [exp]	0	1
AT4G34131		UGT73B3	UDP-glucosyl transferase 73B3 ...		Potri.001G303600 [exp]	10.95	0.8581
AT4G34131		UGT73B3	UDP-glucosyl transferase 73B3 ...		Potri.001G303000 [exp]	11.22	0.8641
AT5G03980			SGNH hydrolase-type esterase s...		Potri.005G024966 [exp]	17.74	0.8240
AT5G05410	AP2_ERF	DREB2A	DEHYDRATION-RESPONSIVE ELEMENT...		Potri.010G183700 [exp]	25.74	0.8361	Pt-DREB2.2
AT4G27340			Met-10+ like family protein (....		Potri.001G408950 [exp]	30.85	0.8189
AT1G56310			Polynucleotidyl transferase, r...		Potri.005G020000 [exp]	30.98	0.8005
AT1G12060		ATBAG5	BCL-2-associated athanogene 5 ...		Potri.003G167500 [exp]	38.65	0.8212
					Potri.018G013850 [exp]	38.72	0.7589
					Potri.018G013875 [exp]	43.26	0.7458
AT2G29500			HSP20-like chaperones superfam...		Potri.019G081250 [exp]	48.37	0.8152

Compare expression of checked genes

Potri.010G025400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.