Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18790 108 / 3e-33 Ribosomal protein L33 family protein (.1) AT3G06320 108 / 3e-33 Ribosomal protein L33 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G396700 [exp] 59 / 8e-13 AT5G18790 58 / 6e-12 Ribosomal protein L33 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012786 [exp] 98 / 4e-29 AT5G18790 106 / 1e-32 Ribosomal protein L33 family protein (.1) Lus10033990 [exp] 101 / 4e-27 AT2G44710 301 / 2e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF00471 [poplar] [flax] Ribosomal_L33 Ribosomal protein L33
Representative CDS sequence Show only first row Show all	>Potri.010G025900.4 pacid=42797017 polypeptide=Potri.010G025900.4.p locus=Potri.010G025900 ID=Potri.010G025900.4.v4.1 annot-version=v4.1 ATGGGTGACAAAAAGAAGAAGACTTTCATGTTCATCCGCCTTGTTTCTGCTGCTGGAACTGGATTCTTCTATGTCAAGAGGAAGAGTGCCAAGAAAGCTT TGGAGAAGCTCGAGTTTCGCAAATACGACCCTCGAGTAAATCGCCATGTTCTTTTTACAGAGGCAAAAATGAAATGA
AA sequence Show only first row Show all	>Potri.010G025900.4 pacid=42797017 polypeptide=Potri.010G025900.4.p locus=Potri.010G025900 ID=Potri.010G025900.4.v4.1 annot-version=v4.1 MGDKKKKTFMFIRLVSAAGTGFFYVKRKSAKKALEKLEFRKYDPRVNRHVLFTEAKMK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G18790			Ribosomal protein L33 family p...		Potri.010G025900 [exp]	0	1
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.011G148700 [exp]	3.31	0.9350	RPL9.5
AT2G39390			Ribosomal L29 family protein ...		Potri.010G212300 [exp]	8.00	0.9134	RPL35.2
AT5G52650			RNA binding Plectin/S10 domain...		Potri.013G027900 [exp]	9.48	0.9035
AT3G52580			Ribosomal protein S11 family p...		Potri.001G218700 [exp]	11.00	0.8933
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.002G190000 [exp]	12.96	0.8854
AT5G04800			Ribosomal S17 family protein (...		Potri.008G017300 [exp]	14.38	0.9047
AT1G07070			Ribosomal protein L35Ae family...		Potri.010G194200 [exp]	15.42	0.8833
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.010G066400 [exp]	15.49	0.8840	Pt-RPL23.6
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	17.77	0.9046	Pt-RPL9.4
AT1G57860			Translation protein SH3-like f...		Potri.006G195400 [exp]	18.49	0.8967

Compare expression of checked genes

Potri.010G025900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.