Potri.010G026900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18850 101 / 1e-29 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G197300 128 / 1e-40 AT5G18850 110 / 3e-33 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033997 109 / 2e-32 AT5G18850 111 / 6e-33 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G026900.1 pacid=42799281 polypeptide=Potri.010G026900.1.p locus=Potri.010G026900 ID=Potri.010G026900.1.v4.1 annot-version=v4.1
ATGGCATCACCGACAACAAGAGTGACATTTCGGCTAGTGGTGGCGATTCTAGTAGTGACGCTCGTCCTCTTCTACGCCGGCCGCCCTCTCTACTGGAAAA
TCTCCGCCACTGTTCAAGAGATCCGCGAGAACAAACGCACCGTCAAACAAGGCATTTCTCAGTTTGTTTACGAAGCGCAGAAATCGGTTGGCTGGTTTCA
CGACGAGTCCGATTCTGGAGCCCGCGAGAACAGGAGAGCGAGGTCACTCTTTTAA
AA sequence
>Potri.010G026900.1 pacid=42799281 polypeptide=Potri.010G026900.1.p locus=Potri.010G026900 ID=Potri.010G026900.1.v4.1 annot-version=v4.1
MASPTTRVTFRLVVAILVVTLVLFYAGRPLYWKISATVQEIRENKRTVKQGISQFVYEAQKSVGWFHDESDSGARENRRARSLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18850 unknown protein Potri.010G026900 0 1
AT5G08370 ATAGAL2 alpha-galactosidase 2 (.1.2) Potri.004G038100 2.82 0.7607
AT5G60920 COB COBRA-like extracellular glyco... Potri.015G060000 5.47 0.7571
AT1G74680 Exostosin family protein (.1) Potri.002G210000 6.92 0.7480
AT1G76490 HMGR1, HMG1, At... 3-HYDROXY-3-METHYLGLUTARYL COA... Potri.002G004000 14.96 0.6281 Pt-HMG1.3
AT1G11820 O-Glycosyl hydrolases family 1... Potri.011G006100 15.49 0.7322
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Potri.002G016300 17.49 0.6324 Pt-SMT1.1
AT1G80170 Pectin lyase-like superfamily ... Potri.001G171900 18.46 0.6907
AT3G54400 Eukaryotic aspartyl protease f... Potri.001G028200 28.19 0.7042
AT1G78700 BZR BEH4 BES1/BZR1 homolog 4 (.1) Potri.011G106800 28.98 0.6367
AT4G36360 BGAL3 beta-galactosidase 3 (.1.2) Potri.005G232600 29.66 0.6756 GAL1.7

Potri.010G026900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.