Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18900 204 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G06300 192 / 3e-60 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1) AT3G28480 148 / 4e-43 Oxoglutarate/iron-dependent oxygenase (.1.2) AT3G28490 135 / 2e-38 Oxoglutarate/iron-dependent oxygenase (.1) AT4G25600 102 / 1e-25 Oxoglutarate/iron-dependent oxygenase (.1) AT4G35810 82 / 2e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G20270 81 / 4e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G17720 78 / 6e-17 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G66060 70 / 4e-14 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G35820 53 / 3e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G197700 [exp] 249 / 1e-82 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G075100 [exp] 144 / 9e-42 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.017G075300 [exp] 113 / 3e-30 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2) Potri.012G142800 [exp] 100 / 6e-25 AT4G25600 278 / 4e-93 Oxoglutarate/iron-dependent oxygenase (.1) Potri.005G108000 [exp] 86 / 1e-19 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.005G245300 [exp] 79 / 2e-17 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G060800 [exp] 77 / 3e-16 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G296800 [exp] 49 / 1e-06 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G091000 [exp] 44 / 3e-05 AT4G33910 431 / 9e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012014 [exp] 211 / 8e-68 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10016271 [exp] 207 / 2e-66 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032183 [exp] 155 / 7e-46 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10014502 [exp] 144 / 1e-41 AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10032184 [exp] 104 / 4e-28 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2) Lus10014973 [exp] 79 / 5e-17 AT4G25600 211 / 9e-67 Oxoglutarate/iron-dependent oxygenase (.1) Lus10005620 [exp] 79 / 8e-17 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028404 [exp] 77 / 2e-16 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041857 [exp] 77 / 2e-16 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10038855 [exp] 76 / 9e-16 AT4G25600 250 / 2e-81 Oxoglutarate/iron-dependent oxygenase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G027201.1 pacid=42798207 polypeptide=Potri.010G027201.1.p locus=Potri.010G027201 ID=Potri.010G027201.1.v4.1 annot-version=v4.1 ATGGCTACTTCGTTCTACCCCTTCCAGTTCCTGTTTCTACTGACGATCTCTGCAACTCTGCATAAATCCAGCTCTTACCTCTGTACTTCGAGCGCCATTA TCAACCCTGCCGAAAGTAAAATTAGCCAAGTTCGAACCAGTTCTGGAATGTTTATCTCTAAAGCAAAGGATCCAATTGTTGCAGGTACAGAGGACAAGAT TGCAACTTGGACTTCTCTCCCAAAAGGGGAGCATTTGCAAATTGGATTTGCCCAAATAGACTATTTTTTTTTCGGAACAGAGGGAGTAATTTCTTGCTAC TCATTGTCATACTGCTTGAAAATGCTTTTGAGTGTCATAGAAGAGCCTATTAAGAAGCTTCTTGTTAATGTTGACCGTGGTGAACACCGGTTGGCAACTG TACTCGTGTATCTTACAGATGTTGAAAAGGGTGGTGAAACGGTCTCCCCTTCAGCTGAGGTCAGACAAATCCCGTTGTGCTTTTCCTTTCATCCAGATCT CTACCCCAATCACTATCCAAGGTGCCCTGTGATTGAAGGTGAGAAATGGTCTGCCACAAAGTGGATTCATGTAGACTCATTTGACAAGAACGTGGAAGCT GGTGGGAATTGCACTGATCAGAATGAAAGTTGTGAGAGGTGGGCAGCCCTTGGAGAACGCACCAAAAACACTGAGTACACGGTTGGGTCACCGGACCTTC CTGGATATTGTAGGAGGAGTTCTAAGGTATGTTAG
AA sequence Show only first row Show all	>Potri.010G027201.1 pacid=42798207 polypeptide=Potri.010G027201.1.p locus=Potri.010G027201 ID=Potri.010G027201.1.v4.1 annot-version=v4.1 MATSFYPFQFLFLLTISATLHKSSSYLCTSSAIINPAESKISQVRTSSGMFISKAKDPIVAGTEDKIATWTSLPKGEHLQIGFAQIDYFFFGTEGVISCY SLSYCLKMLLSVIEEPIKKLLVNVDRGEHRLATVLVYLTDVEKGGETVSPSAEVRQIPLCFSFHPDLYPNHYPRCPVIEGEKWSATKWIHVDSFDKNVEA GGNCTDQNESCERWAALGERTKNTEYTVGSPDLPGYCRRSSKVC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G18900			2-oxoglutarate (2OG) and Fe(II...		Potri.010G027201 [exp]	0	1
AT4G27680			P-loop containing nucleoside t...		Potri.012G025351 [exp]	2.82	0.8738
AT4G30770			Putative membrane lipoprotein ...		Potri.007G103000 [exp]	6.63	0.8497
AT5G07670			RNI-like superfamily protein (...		Potri.014G059100 [exp]	10.39	0.8408
AT2G32700		MUM1, LUH	MUCILAGE-MODIFIED 1, LEUNIG_ho...		Potri.002G241800 [exp]	12.96	0.8459
AT5G07900			Mitochondrial transcription te...		Potri.001G034500 [exp]	15.87	0.8487
AT1G55800			Domain of unknown function (DU...		Potri.016G003066 [exp]	17.05	0.7679
AT3G22560			Acyl-CoA N-acyltransferases (N...		Potri.007G102900 [exp]	17.29	0.8144
AT4G03420			Protein of unknown function (D...		Potri.013G144000 [exp]	17.74	0.7970
AT1G27840		ATCSA-1	Transducin/WD40 repeat-like su...		Potri.014G016100 [exp]	20.19	0.8135
AT5G17370			Transducin/WD40 repeat-like su...		Potri.003G155900 [exp]	21.02	0.8311

Compare expression of checked genes

Potri.010G027201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.