Potri.010G028000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18920 88 / 8e-25 Cox19-like CHCH family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G198500 125 / 1e-39 AT5G18920 90 / 2e-25 Cox19-like CHCH family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034006 91 / 7e-26 AT5G18920 87 / 2e-24 Cox19-like CHCH family protein (.1)
PFAM info
Representative CDS sequence
>Potri.010G028000.2 pacid=42798777 polypeptide=Potri.010G028000.2.p locus=Potri.010G028000 ID=Potri.010G028000.2.v4.1 annot-version=v4.1
ATGGCTGAGCCTCCAAACCAAACACACCCGTCTCCACAACAACCGCTTCACCAGATCGATGCAGATGAGGACGATGACAACGTTAAGCAACTCAAACAAT
GCTCCTCTCTCTACCTCTCCCTACAGGAATGCCTTGTTAATTCCAACAGAAACTGGAAGTCTTGCCAAAAGGAAGTTCATGCTTTGAAGGTTTGTAATGA
GAGGATGAAGAATGACAAGGGGAAGTGA
AA sequence
>Potri.010G028000.2 pacid=42798777 polypeptide=Potri.010G028000.2.p locus=Potri.010G028000 ID=Potri.010G028000.2.v4.1 annot-version=v4.1
MAEPPNQTHPSPQQPLHQIDADEDDDNVKQLKQCSSLYLSLQECLVNSNRNWKSCQKEVHALKVCNERMKNDKGK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18920 Cox19-like CHCH family protein... Potri.010G028000 0 1
AT1G48140 DPMS3 dolichol phosphate mannose syn... Potri.002G245800 1.73 0.8896
AT1G13330 AHP2 Arabidopsis Hop2 homolog (.1) Potri.008G118800 5.09 0.8131
AT2G01930 BBR_BPC BPC1, BBR/BPC1,... basic pentacysteine1 (.1.2) Potri.008G140200 5.47 0.8343
AT1G66590 ATCOX19-1 A. THALIANA CYTOCHROME C OXIDA... Potri.001G187200 6.32 0.8406
AT1G01230 ORMDL family protein (.1) Potri.002G174400 9.59 0.8419
AT4G00026 SD3 SEGREGATION DISTORTION 3, unkn... Potri.014G054400 13.85 0.7249
AT5G52370 unknown protein Potri.009G040100 15.42 0.8064
AT5G57280 RID2 root initiation defective 2, S... Potri.018G049800 18.16 0.8052
AT1G01910 P-loop containing nucleoside t... Potri.002G152500 21.97 0.7839
AT3G15395 unknown protein Potri.001G402000 23.91 0.8168

Potri.010G028000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.