Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63088 48 / 6e-10 RTFL14, DVL14 DEVIL 14, ROTUNDIFOLIA like 14 (.1) AT3G23635 43 / 6e-08 RTFL13 ROTUNDIFOLIA like 13 (.1) AT4G13395 35 / 0.0002 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT3G55515 35 / 0.0003 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G39705 34 / 0.001 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G202000 [exp] 82 / 4e-23 AT3G63088 50 / 1e-10 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.014G138900 [exp] 64 / 3e-16 AT3G63088 56 / 7e-13 DEVIL 14, ROTUNDIFOLIA like 14 (.1) Potri.001G161200 [exp] 37 / 3e-05 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.003G073900 [exp] 35 / 0.0002 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1) Potri.010G226250 [exp] 34 / 0.0003 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.006G125600 [exp] 34 / 0.0003 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G035900 [exp] 33 / 0.0009 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041259 [exp] 34 / 0.0003 AT1G53708 70 / 2e-17 ROTUNDIFOLIA like 9 (.1) Lus10034272 [exp] 34 / 0.0004 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10041491 [exp] 34 / 0.0006 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [poplar] [flax] DVL DVL family
Representative CDS sequence Show only first row Show all	>Potri.010G030100.1 pacid=42798911 polypeptide=Potri.010G030100.1.p locus=Potri.010G030100 ID=Potri.010G030100.1.v4.1 annot-version=v4.1 ATGGCCAGAAACTTGCCCACAATGAGATTGCCAAAGCTCCGACCGTGGCAAAGGTGTTCAAGAAAGGTTCGAGAGCAGAGAACGCGTTTGTATATCATAT GGAGGTGTACAGTGATTCTCCTACGCTGGGATGAGTAA
AA sequence Show only first row Show all	>Potri.010G030100.1 pacid=42798911 polypeptide=Potri.010G030100.1.p locus=Potri.010G030100 ID=Potri.010G030100.1.v4.1 annot-version=v4.1 MARNLPTMRLPKLRPWQRCSRKVREQRTRLYIIWRCTVILLRWDE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G63088		RTFL14, DVL14	DEVIL 14, ROTUNDIFOLIA like 14...		Potri.010G030100 [exp]	0	1
					Potri.005G168401 [exp]	7.34	0.9726
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.001G189900 [exp]	10.48	0.9711
AT4G08300			nodulin MtN21 /EamA-like trans...		Potri.005G176200 [exp]	11.22	0.9711
					Potri.007G034000 [exp]	12.12	0.9701
					Potri.007G034101 [exp]	13.56	0.9691
					Potri.009G081850 [exp]	14.14	0.9613
					Potri.006G163201 [exp]	14.73	0.7640
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.008G079066 [exp]	16.91	0.9599
AT3G30340			nodulin MtN21 /EamA-like trans...		Potri.014G108500 [exp]	17.86	0.9609
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.002G035000 [exp]	19.79	0.9565

Compare expression of checked genes

Potri.010G030100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.