Plant FIBer expression Database

Potri.010G031700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G195700
[exp]
60 / 2e-12 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G031700.4 pacid=42797376 polypeptide=Potri.010G031700.4.p locus=Potri.010G031700 ID=Potri.010G031700.4.v4.1 annot-version=v4.1
ATGGCCTCCTTTTGTTTTTTCATAGTACTCATTGTGCCTTTAATGATCTTTCCTTTGCTTTCTTCTTCCACTCAGCTAAATTCAAAAACCTCGCCTTATC
CTATCTCTACTTCACCACCATTCCTAACCAATCCTCCTCCACCATCTCCTCTCCAAGAACTGTCACCGGACATTGCTCCACTATTGCCTTCTCCTGGTGG
TGTGCTACCTTCCCCAACCGTATCGTCGGTTCCCACCATTCCCTCCACCCCAAGCCCGCCTAATCCAGATGAGGTGGTGGCACCAGGGCCTGCTTCTGCT
TTCTCACCCCTAGGAGCATTGCCGGCTTCCTCTGCATCGCCACGAAATTTGATAAACTTTGCTATTGCTGTGGGGTGTATAGCATATTGGTCAATCTAG
AA sequence
>Potri.010G031700.4 pacid=42797376 polypeptide=Potri.010G031700.4.p locus=Potri.010G031700 ID=Potri.010G031700.4.v4.1 annot-version=v4.1
MASFCFFIVLIVPLMIFPLLSSSTQLNSKTSPYPISTSPPFLTNPPPPSPLQELSPDIAPLLPSPGGVLPSPTVSSVPTIPSTPSPPNPDEVVAPGPASA
FSPLGALPASSASPRNLINFAIAVGCIAYWSI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G031700
[exp]
0 1
AT3G20860 ATNEK5 NIMA-related kinase 5 (.1) Potri.001G018700
[exp]
9.79 0.8263
AT5G18610 Protein kinase superfamily pro... Potri.010G215100
[exp]
16.18 0.8517
AT1G03620 ELMO/CED-12 family protein (.1... Potri.013G136200
[exp]
19.10 0.8383
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.001G012300
[exp]
20.34 0.7617
AT4G03965 RING/U-box superfamily protein... Potri.002G224200
[exp]
23.66 0.8296
AT5G67200 Leucine-rich repeat protein ki... Potri.005G141200
[exp]
23.81 0.8304
AT1G10550 XTH33, XET xyloglucan:xyloglucosyl transf... Potri.014G115000
[exp]
25.69 0.8273 Pt-XTH33.1
AT5G62865 unknown protein Potri.012G078300
[exp]
31.84 0.8374
AT4G34660 SH3 domain-containing protein ... Potri.009G123200
[exp]
41.70 0.7988
AT3G54650 FBL17 RNI-like superfamily protein (... Potri.005G218400
[exp]
42.44 0.8191

Potri.010G031700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.