Potri.010G033133 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G43760 87 / 9e-20 DNAse I-like superfamily protein (.1)
AT1G40390 79 / 5e-17 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G000601 306 / 2e-107 AT1G43760 109 / 9e-28 DNAse I-like superfamily protein (.1)
Potri.002G209244 305 / 2e-107 AT1G43760 94 / 1e-22 DNAse I-like superfamily protein (.1)
Potri.004G128901 314 / 3e-107 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Potri.004G128921 314 / 3e-107 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128880 314 / 3e-107 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128860 314 / 3e-107 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 314 / 3e-107 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128941 314 / 3e-107 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.005G151275 314 / 3e-105 AT1G43760 268 / 1e-81 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.010G033133.1 pacid=42798818 polypeptide=Potri.010G033133.1.p locus=Potri.010G033133 ID=Potri.010G033133.1.v4.1 annot-version=v4.1
ATGGGCAATTTTAATGCTATCCGCAACCAGTCAGACAGGTTAGGAGGGTCTTCTACGTGGGCTGGCACTATGGACAGATTGGAAACATGTATTCAAGGAG
CGAAAGTAGATGATCTTCGGTATTCAGGTATGCATTATACTTGGTCGAACCAATGTCCTGAGAATCTGATTATGCAGAAACTAGATAAAGTGCTTGTCAA
TGAGAAGTGGAATCTGAACTTCCCATTGTTGGAAGCGAGATTTTTTCCTTGGGGTATGTCAGACCATTCTCCTATGGTGGTAAAGGTTACTAGCAATGAT
CATAACATAAAGAAACCATTCAGATTCTTCGATATGTGGATGGATCATGACGAGTTCATGCCCTTGGTGAAGAAGGTATGGGAGCCGATTTCGGGGGGTT
GTCCAATGTATCAGCTATGTTGCAAACTAAGAAAGCTAAAGCAGGAATTGAAACTTTTCAATATGGCTCACTTCTCCAACATTTCACTGTTGTTTGTTCG
GTGGCTAGCCTGTCGCCATCTGTTGTTTTATGTTTCTGTTCTCATTGTAAATCTGGGGTTGTTGTGTGAATTGCTAAGTGATGAAATTATCACTGACAAC
GGAAATATGAGAAGTGTGATATGGGGTGTAGACTAG
AA sequence
>Potri.010G033133.1 pacid=42798818 polypeptide=Potri.010G033133.1.p locus=Potri.010G033133 ID=Potri.010G033133.1.v4.1 annot-version=v4.1
MGNFNAIRNQSDRLGGSSTWAGTMDRLETCIQGAKVDDLRYSGMHYTWSNQCPENLIMQKLDKVLVNEKWNLNFPLLEARFFPWGMSDHSPMVVKVTSND
HNIKKPFRFFDMWMDHDEFMPLVKKVWEPISGGCPMYQLCCKLRKLKQELKLFNMAHFSNISLLFVRWLACRHLLFYVSVLIVNLGLLCELLSDEIITDN
GNMRSVIWGVD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G43760 DNAse I-like superfamily prote... Potri.010G033133 0 1
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G114900 2.44 0.9685
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Potri.012G112800 3.00 0.9376
Potri.007G065950 3.16 0.8844
AT5G28780 PIF1 helicase (.1) Potri.003G004501 5.65 0.9121
Potri.012G100750 6.32 0.9121
Potri.018G119450 7.41 0.8761
AT4G09960 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-... Potri.013G104900 7.93 0.9014 AGL11.2
AT5G40780 LHT1, LTH1 lysine histidine transporter 1... Potri.015G091600 11.66 0.7374 PtrLHT1
AT1G43760 DNAse I-like superfamily prote... Potri.003G047001 12.64 0.7741
AT3G30180 CYP85A2, BR6OX2 brassinosteroid-6-oxidase 2 (.... Potri.010G156800 12.64 0.7203

Potri.010G033133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.