Potri.010G041200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10600 256 / 2e-87 AMSH2 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
AT4G16144 213 / 1e-66 AMSH3 associated molecule with the SH3 domain of STAM 3 (.1)
AT1G48790 211 / 5e-66 AMSH1 associated molecule with the SH3 domain of STAM 1 (.1)
AT5G23540 46 / 8e-06 Mov34/MPN/PAD-1 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G141100 213 / 7e-67 AT4G16144 697 / 0.0 associated molecule with the SH3 domain of STAM 3 (.1)
Potri.015G045800 193 / 5e-59 AT1G48790 581 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Potri.014G032900 50 / 3e-07 AT5G23540 563 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Potri.002G127900 50 / 4e-07 AT5G23540 567 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Potri.018G006100 40 / 0.001 AT1G22920 589 / 0.0 ARABIDOPSIS JAB1 HOMOLOG 1, COP9 signalosome 5A (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030875 310 / 4e-108 AT1G10600 311 / 2e-108 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
Lus10030613 268 / 2e-91 AT1G10600 253 / 5e-85 associated molecule with the SH3 domain of STAM 2 (.1.2.3)
Lus10036454 207 / 2e-64 AT4G16144 645 / 0.0 associated molecule with the SH3 domain of STAM 3 (.1)
Lus10009006 197 / 2e-60 AT1G48790 589 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Lus10009634 125 / 2e-33 AT1G48790 536 / 0.0 associated molecule with the SH3 domain of STAM 1 (.1)
Lus10031085 51 / 1e-07 AT5G23540 599 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10035470 51 / 1e-07 AT5G23540 601 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10042663 47 / 5e-06 AT5G23540 616 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10021746 47 / 5e-06 AT5G23540 618 / 0.0 Mov34/MPN/PAD-1 family protein (.1.2)
Lus10020149 40 / 0.0007 AT2G07560 469 / 1e-155 H\(+\)-ATPase 6, H\(+\)-ATPase 6, H(+)-ATPase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0366 JAB PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease
Representative CDS sequence
>Potri.010G041200.12 pacid=42798754 polypeptide=Potri.010G041200.12.p locus=Potri.010G041200 ID=Potri.010G041200.12.v4.1 annot-version=v4.1
ATGACTCAGACAGACAGCAAATGTGAGCATATCACCGTTCACACTGTTACTCAGACTTCTCCATGTCCTATACTCTCATGTGTAGAGAAAGCACCTAAAT
ATGCTCATGTTTCACTTATACCAGTTGCTGATTCAGATCAAAGCTCATGCAATCAACCATCAGCATCCGGGGTCTTGCAAGATGTACACATAGAGCATGG
AACCTATTACGTCACCACTCTAATAATACCAAAACAAGATTCAACTTCCTCTTCTTGCGAGGCTTTAAAAGAGGAAGAGTTTTTTGCCATACAGAATGAA
CGTTCTCTTTTTCCTGTTGGGTGGATTCATACACATCCTTCTCAAAGCTGTTTCATGTCATCAATTGACCTACATACTCACTTTTCATATCAGGCAATGG
TACCTGAGGCATTTGCCATTGTCATGGCTCCAACTGATCAGTCAAGGAGCTATGGAATATTCAGGTTATCTGACCCAGGTGGGATGAGTGTTCTGAAAGA
GTGTGAAGAGTCAGGGTTTCATCCTCATGGAGAACCGGCAGATGGGAGCCCCATTTACGAGCACTGCGCCAATGTATTCACAAATACTAATCTGAGGTTT
GAAATCTTTGACTTACGCTGA
AA sequence
>Potri.010G041200.12 pacid=42798754 polypeptide=Potri.010G041200.12.p locus=Potri.010G041200 ID=Potri.010G041200.12.v4.1 annot-version=v4.1
MTQTDSKCEHITVHTVTQTSPCPILSCVEKAPKYAHVSLIPVADSDQSSCNQPSASGVLQDVHIEHGTYYVTTLIIPKQDSTSSSCEALKEEEFFAIQNE
RSLFPVGWIHTHPSQSCFMSSIDLHTHFSYQAMVPEAFAIVMAPTDQSRSYGIFRLSDPGGMSVLKECEESGFHPHGEPADGSPIYEHCANVFTNTNLRF
EIFDLR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G10600 AMSH2 associated molecule with the S... Potri.010G041200 0 1
AT3G62620 sucrose-phosphatase-related (.... Potri.002G198200 1.73 0.8345
AT1G02680 TAF13 TBP-associated factor 13 (.1) Potri.014G122500 2.00 0.8351
AT3G14205 Phosphoinositide phosphatase f... Potri.001G163900 4.89 0.8151
AT1G55140 Ribonuclease III family protei... Potri.003G038400 5.00 0.8238
AT1G22940 THIE, TH-1, TH1 THIAMINEE, THIAMINE REQUIRING ... Potri.003G015700 5.29 0.8284 Pt-TH1.1
AT1G56190 Phosphoglycerate kinase family... Potri.016G091800 6.70 0.8062
AT3G10250 Plant protein 1589 of unknown ... Potri.016G038100 9.38 0.8074
AT3G15420 Transcription factor TFIIIC, t... Potri.011G121800 11.18 0.7687
AT1G69010 bHLH bHLH102, BIM2 BES1-interacting Myc-like prot... Potri.004G112900 11.48 0.7699
AT4G29540 AtLpxA bacterial transferase hexapept... Potri.006G150200 14.42 0.7784

Potri.010G041200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.