Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10657 119 / 2e-36 Plant protein 1589 of unknown function (.1.2.3.4) AT3G55240 90 / 4e-25 Plant protein 1589 of unknown function (.1) AT5G02580 77 / 8e-20 Plant protein 1589 of unknown function (.1.2) AT3G28990 77 / 9e-20 Plant protein 1589 of unknown function (.1) AT2G46420 67 / 2e-14 Plant protein 1589 of unknown function (.1.2) AT5G04090 66 / 3e-14 Plant protein 1589 of unknown function (.1.2) AT3G10250 66 / 4e-14 Plant protein 1589 of unknown function (.1.2) AT3G61700 64 / 2e-13 Plant protein 1589 of unknown function (.1.2) AT3G45800 44 / 3e-06 Plant protein 1589 of unknown function (.1) AT2G29605 39 / 0.0002 Plant protein 1589 of unknown function (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G189100 [exp] 148 / 3e-48 AT1G10657 122 / 8e-38 Plant protein 1589 of unknown function (.1.2.3.4) Potri.010G211500 [exp] 90 / 9e-25 AT3G55240 113 / 3e-34 Plant protein 1589 of unknown function (.1) Potri.006G213500 [exp] 83 / 2e-22 AT5G02580 96 / 2e-27 Plant protein 1589 of unknown function (.1.2) Potri.006G041200 [exp] 69 / 4e-15 AT3G10250 396 / 4e-139 Plant protein 1589 of unknown function (.1.2) Potri.002G169900 [exp] 66 / 5e-14 AT2G46420 500 / 1e-178 Plant protein 1589 of unknown function (.1.2) Potri.014G097800 [exp] 65 / 9e-14 AT2G46420 503 / 5e-180 Plant protein 1589 of unknown function (.1.2) Potri.016G038100 [exp] 64 / 2e-13 AT3G10250 381 / 5e-133 Plant protein 1589 of unknown function (.1.2) Potri.012G001700 [exp] 63 / 5e-13 AT2G46420 165 / 3e-48 Plant protein 1589 of unknown function (.1.2) Potri.015G019500 [exp] 62 / 1e-12 AT3G61700 161 / 1e-46 Plant protein 1589 of unknown function (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025300 [exp] 82 / 2e-21 AT5G02580 115 / 5e-35 Plant protein 1589 of unknown function (.1.2) Lus10024432 [exp] 81 / 4e-21 AT5G02580 112 / 1e-33 Plant protein 1589 of unknown function (.1.2) Lus10035397 [exp] 69 / 7e-15 AT3G23270 526 / 2e-171 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10031001 [exp] 67 / 2e-14 AT3G10250 392 / 3e-137 Plant protein 1589 of unknown function (.1.2) Lus10004016 [exp] 65 / 5e-14 AT3G61700 253 / 3e-83 Plant protein 1589 of unknown function (.1.2) Lus10030264 [exp] 61 / 5e-12 AT2G46420 346 / 4e-117 Plant protein 1589 of unknown function (.1.2) Lus10019011 [exp] 59 / 2e-11 AT3G61700 212 / 4e-66 Plant protein 1589 of unknown function (.1.2) Lus10039340 [exp] 56 / 2e-10 AT3G61700 182 / 6e-55 Plant protein 1589 of unknown function (.1.2) Lus10003293 [exp] 52 / 4e-10 AT3G55240 85 / 2e-23 Plant protein 1589 of unknown function (.1) Lus10030322 [exp] 52 / 4e-10 AT3G55240 83 / 1e-22 Plant protein 1589 of unknown function (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09713 [poplar] [flax] A_thal_3526 Plant protein 1589 of unknown function (A_thal_3526)
Representative CDS sequence Show only first row Show all	>Potri.010G042300.6 pacid=42799295 polypeptide=Potri.010G042300.6.p locus=Potri.010G042300 ID=Potri.010G042300.6.v4.1 annot-version=v4.1 ATGTATCATTACGGCCACCACCATCGTCTTCCTTGCTTGCGTTGCCACCCACATAGCTACATTAGGATGGTTCAGCATCTGATAGAGAGATGTTTGCTCC TTCACATGAGTAGAGACCAATGCGTGAAGGCACTGGCTAAGCATGCTAGCGTTCATCCACTTGTTACACTTACAGTGTGGAGAGAACTACAGCAGGAGAA TAGGGAATTCTTTCATGCATATTTCCATTCAATTTCTCCAAGGCATTTCACGAGCAGGCGTACTCGAAGGGTGTTGAGATTAACAAGGGAAATATAA
AA sequence Show only first row Show all	>Potri.010G042300.6 pacid=42799295 polypeptide=Potri.010G042300.6.p locus=Potri.010G042300 ID=Potri.010G042300.6.v4.1 annot-version=v4.1 MYHYGHHHRLPCLRCHPHSYIRMVQHLIERCLLLHMSRDQCVKALAKHASVHPLVTLTVWRELQQENREFFHAYFHSISPRHFTSRRTRRVLRLTREI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G10657			Plant protein 1589 of unknown ...		Potri.010G042300 [exp]	0	1
AT3G56940		CRD1, CHL27, AC...	COPPER RESPONSE DEFECT 1, dica...		Potri.006G027300 [exp]	7.74	0.9272	Pt-AT103.2
AT4G04330		AtRbcX1	homologue of cyanobacterial Rb...		Potri.011G010300 [exp]	17.60	0.9265
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.018G089300 [exp]	20.83	0.9217
AT3G59400		GUN4	GENOMES UNCOUPLED 4, enzyme bi...		Potri.007G128200 [exp]	20.88	0.9260	GUN4.2
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Potri.018G088600 [exp]	22.44	0.9203
AT1G32520			unknown protein		Potri.003G089900 [exp]	23.68	0.9264
					Potri.002G021900 [exp]	28.00	0.8749
					Potri.008G210450 [exp]	33.46	0.9215
AT1G49975			unknown protein		Potri.009G086400 [exp]	33.49	0.9237
AT4G27700			Rhodanese/Cell cycle control p...		Potri.012G020700 [exp]	36.53	0.9255

Compare expression of checked genes

Potri.010G042300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.