Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10690 92 / 3e-25 unknown protein AT5G40460 79 / 4e-20 unknown protein AT1G60783 73 / 5e-18 unknown protein AT3G27630 51 / 2e-09 unknown protein AT1G51355 43 / 3e-06 unknown protein AT3G20898 40 / 3e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G187300 [exp] 169 / 4e-56 AT5G40460 97 / 3e-27 unknown protein Potri.017G070000 [exp] 103 / 8e-30 AT5G40460 89 / 3e-24 unknown protein Potri.016G053900 [exp] 45 / 7e-07 AT3G20898 68 / 5e-16 unknown protein Potri.006G053600 [exp] 41 / 1e-05 AT3G20898 67 / 1e-15 unknown protein Potri.001G257700 [exp] 40 / 4e-05 AT3G20898 78 / 1e-19 unknown protein Potri.009G053000 [exp] 40 / 5e-05 AT3G20898 76 / 9e-19 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002514 [exp] 66 / 4e-15 AT5G40460 105 / 7e-31 unknown protein Lus10022268 [exp] 57 / 7e-12 AT5G40460 96 / 3e-27 unknown protein Lus10006204 [exp] 56 / 4e-11 AT1G60783 77 / 9e-20 unknown protein Lus10004622 [exp] 50 / 5e-09 AT1G60783 51 / 9e-10 unknown protein Lus10026693 [exp] 47 / 5e-08 AT1G60783 47 / 5e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G045200.1 pacid=42799591 polypeptide=Potri.010G045200.1.p locus=Potri.010G045200 ID=Potri.010G045200.1.v4.1 annot-version=v4.1 ATGGGGTTCTCGAAGAAGCCTCCAGCCGTGGATGGTGGCTTGGACTTAGATGGTGGTAAGAGATGGGTTATTGCTGGGATTCCTTTAAGAGCTCCTTTAA AGCCCATATCTACAAATCCAGTGGAGAAAGAGATCAACGAAGATGATGATCAGAGTAACTGTACTACTGCTTCAACAACGCCTACCAGTGAAGAAGCAAG AATTCCTTCTAGACTGGTGTGCCCTCCGGCTCCCAGGAAGCGAAAAGCTACTTTCAAGTGTAATTATACCAGTGGTGTTAGGGAGTTCTTTACCCCCCCT GACTTGGAAACCCTTTTTGTACAAAGGGCAAACTGA
AA sequence Show only first row Show all	>Potri.010G045200.1 pacid=42799591 polypeptide=Potri.010G045200.1.p locus=Potri.010G045200 ID=Potri.010G045200.1.v4.1 annot-version=v4.1 MGFSKKPPAVDGGLDLDGGKRWVIAGIPLRAPLKPISTNPVEKEINEDDDQSNCTTASTTPTSEEARIPSRLVCPPAPRKRKATFKCNYTSGVREFFTPP DLETLFVQRAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G10690			unknown protein		Potri.010G045200 [exp]	0	1
					Potri.012G082300 [exp]	1.00	0.9248
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Potri.001G334700 [exp]	2.44	0.9090
AT1G66140	C2H2ZnF	ZFP4	zinc finger protein 4 (.1)		Potri.017G134800 [exp]	2.64	0.8680	Pt-ZFP4.1
AT5G06800	GARP		myb-like HTH transcriptional r...		Potri.006G191000 [exp]	4.89	0.8679
AT5G65550			UDP-Glycosyltransferase superf...		Potri.010G182650 [exp]	5.19	0.8468
AT3G49290		ABIL2	ABL interactor-like protein 2 ...		Potri.001G088100 [exp]	5.29	0.8467
AT2G37210		LOG3	LONELY GUY 3, lysine decarboxy...		Potri.002G024000 [exp]	5.56	0.8463
AT5G15070			Phosphoglycerate mutase-like f...		Potri.017G076400 [exp]	8.36	0.8720
AT3G14470			NB-ARC domain-containing disea...		Potri.018G017900 [exp]	8.48	0.8883	Pt-RGA.54
AT1G33540		SCPL18	serine carboxypeptidase-like 1...		Potri.001G290900 [exp]	9.16	0.8626

Compare expression of checked genes

Potri.010G045200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.