Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67910 84 / 1e-22 unknown protein AT1G24577 66 / 6e-16 unknown protein AT5G55980 52 / 7e-10 serine-rich protein-related (.1) AT3G13227 44 / 9e-07 serine-rich protein-related (.1) AT3G56500 43 / 1e-06 serine-rich protein-related (.1) AT5G20370 43 / 3e-06 serine-rich protein-related (.1) AT5G25280 39 / 0.0001 serine-rich protein-related (.1.2) AT5G11090 38 / 0.0004 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G186200 [exp] 159 / 1e-52 AT1G67910 85 / 4e-23 unknown protein Potri.018G079200 [exp] 49 / 6e-09 AT1G67910 45 / 9e-08 unknown protein Potri.002G250700 [exp] 49 / 2e-08 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.001G371400 [exp] 49 / 2e-08 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.006G159300 [exp] 42 / 4e-06 AT1G24577 43 / 5e-07 unknown protein Potri.018G078900 [exp] 40 / 9e-06 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.006G060700 [exp] 40 / 3e-05 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.018G023300 [exp] 40 / 7e-05 AT5G11090 194 / 1e-62 serine-rich protein-related (.1) Potri.018G120300 [exp] 39 / 7e-05 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026701 [exp] 65 / 4e-15 AT1G67910 56 / 5e-12 unknown protein Lus10000442 [exp] 64 / 8e-15 AT1G67910 56 / 1e-11 unknown protein Lus10023632 [exp] 47 / 4e-08 AT1G67910 48 / 1e-08 unknown protein Lus10023227 [exp] 47 / 8e-08 AT5G55980 69 / 3e-16 serine-rich protein-related (.1) Lus10008880 [exp] 47 / 8e-08 AT5G55980 63 / 1e-13 serine-rich protein-related (.1) Lus10034901 [exp] 46 / 8e-08 AT1G67910 49 / 6e-09 unknown protein Lus10039998 [exp] 42 / 2e-05 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2) Lus10008808 [exp] 41 / 2e-05 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2) Lus10023630 [exp] 40 / 2e-05 AT1G67910 44 / 2e-07 unknown protein Lus10043215 [exp] 40 / 3e-05 AT5G55980 44 / 8e-07 serine-rich protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G046700.3 pacid=42797359 polypeptide=Potri.010G046701.1.p locus=Potri.010G046700 ID=Potri.010G046700.3.v4.1 annot-version=v4.1 ATGGAGAGTGGACAAATGGTCAACAAGGGCATGAAGGTAGAGAATCCATCAGAGACTGAAAGCATGTCAAGTGGTGGCACAAAGTTTACTTCAGGGTTTC AAAGACAGACAGGCGCTTCAAAGAGTAATTGCTTATGCTCTCCAACCTCCCATGCTGGTTCTTTCCGGTGCAGGTTACACCGTTCCCCGAGCCTTCAACG AACCAAAAGCATTGACTCTGCATCTCTGAGAGACTCAGAAACTAATATCAACACGACAGCTGATGATACTAGTAATGCACACAATTGA
AA sequence Show only first row Show all	>Potri.010G046700.3 pacid=42797359 polypeptide=Potri.010G046701.1.p locus=Potri.010G046700 ID=Potri.010G046700.3.v4.1 annot-version=v4.1 MESGQMVNKGMKVENPSETESMSSGGTKFTSGFQRQTGASKSNCLCSPTSHAGSFRCRLHRSPSLQRTKSIDSASLRDSETNINTTADDTSNAHN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G67910			unknown protein		Potri.010G046700 [exp]	0	1
AT1G56700			Peptidase C15, pyroglutamyl pe...		Potri.013G005100 [exp]	3.46	0.9025
AT3G56370			Leucine-rich repeat protein ki...		Potri.016G137000 [exp]	5.29	0.9070
AT5G06470			Glutaredoxin family protein (....		Potri.006G201300 [exp]	5.74	0.9057
AT5G01090			Concanavalin A-like lectin fam...		Potri.006G094900 [exp]	8.36	0.8776
AT1G16860			Ubiquitin-specific protease fa...		Potri.010G252000 [exp]	9.48	0.8940
AT5G62710			Leucine-rich repeat protein ki...		Potri.012G071100 [exp]	13.26	0.8932
AT2G38370			Plant protein of unknown funct...		Potri.016G133300 [exp]	17.49	0.8943
AT4G33945			ARM repeat superfamily protein...		Potri.004G144100 [exp]	18.00	0.9058
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Potri.001G222200 [exp]	19.10	0.9018	Pt-ACCAL.3
AT4G02010			Protein kinase superfamily pro...		Potri.002G194700 [exp]	20.19	0.8921

Compare expression of checked genes

Potri.010G046700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.