Potri.010G047100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67856 133 / 4e-41 RING/U-box superfamily protein (.1)
AT1G24580 101 / 9e-29 RING/U-box superfamily protein (.1)
AT2G04240 84 / 2e-21 XERICO RING/U-box superfamily protein (.1.2)
AT3G61460 67 / 8e-15 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G63840 62 / 8e-13 RING/U-box superfamily protein (.1)
AT1G63170 62 / 3e-12 Zinc finger, C3HC4 type (RING finger) family protein (.1)
AT2G01150 59 / 5e-12 RHA2B RING-H2 finger protein 2B (.1)
AT4G32600 61 / 1e-11 RING/U-box superfamily protein (.1)
AT3G61180 59 / 4e-11 RING/U-box superfamily protein (.1)
AT5G45290 59 / 6e-11 RING/U-box superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G185800 187 / 2e-62 AT1G67856 127 / 2e-38 RING/U-box superfamily protein (.1)
Potri.014G170400 92 / 1e-24 AT2G04240 181 / 3e-59 RING/U-box superfamily protein (.1.2)
Potri.014G087700 71 / 3e-16 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.002G161900 69 / 2e-15 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.007G086300 66 / 2e-14 AT1G15100 79 / 5e-19 RING-H2 finger A2A (.1)
Potri.005G081300 65 / 4e-14 AT2G01150 75 / 1e-17 RING-H2 finger protein 2B (.1)
Potri.005G081200 62 / 1e-12 AT1G15100 74 / 3e-17 RING-H2 finger A2A (.1)
Potri.007G086100 61 / 2e-12 AT2G01150 71 / 3e-16 RING-H2 finger protein 2B (.1)
Potri.008G125700 60 / 4e-12 AT2G01150 125 / 5e-37 RING-H2 finger protein 2B (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011416 137 / 2e-42 AT1G67856 124 / 1e-37 RING/U-box superfamily protein (.1)
Lus10019150 67 / 6e-15 AT2G04240 62 / 6e-13 RING/U-box superfamily protein (.1.2)
Lus10008283 64 / 2e-13 AT3G61460 77 / 5e-18 brassinosteroid-responsive RING-H2 (.1)
Lus10007936 63 / 2e-13 AT2G01150 104 / 3e-29 RING-H2 finger protein 2B (.1)
Lus10008106 66 / 3e-13 AT4G32600 410 / 1e-141 RING/U-box superfamily protein (.1)
Lus10007937 63 / 3e-13 AT1G15100 100 / 2e-27 RING-H2 finger A2A (.1)
Lus10013475 63 / 3e-13 AT2G01150 104 / 2e-29 RING-H2 finger protein 2B (.1)
Lus10036378 64 / 4e-13 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10013144 64 / 7e-13 AT4G32600 477 / 2e-167 RING/U-box superfamily protein (.1)
Lus10034407 61 / 8e-13 AT2G04240 61 / 2e-12 RING/U-box superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0229 RING PF13639 zf-RING_2 Ring finger domain
Representative CDS sequence
>Potri.010G047100.1 pacid=42799354 polypeptide=Potri.010G047100.1.p locus=Potri.010G047100 ID=Potri.010G047100.1.v4.1 annot-version=v4.1
ATGGGGCTCTCAAGTTTCCCTGGTGCAGCTGAAGGAGTGCTGCCTGTGCTGGTAATGAACACAGTCTTATCAGTTGCTCTGCTTAAGAGCATGGTGAGGT
CAGTGCTGCAATTAGTGGTGGGTGCAAATTGGACTCCGCCAGATTATGAGGAAGAACCAGACGAGTATCGTCGAGAAAATGCGAGAGAGAGAAGAATATC
AATAACCCAGTTCAAGTCTTTGAACCAGAATGATGGCGGTGCTAGGAATAGTGCCATGGAATGTTGTGTGTGCCTTTGTGGGTTTGAAGCTGAAGAGGAG
GTGAGTGAGCTTTCTTGCAAGCATTTCTTCCACAGAGGTTGTTTAGACAAGTGGTTTGATAACATCCATGCTACCTGCCCTCTTTGTCGATCTAACCTTT
AA
AA sequence
>Potri.010G047100.1 pacid=42799354 polypeptide=Potri.010G047100.1.p locus=Potri.010G047100 ID=Potri.010G047100.1.v4.1 annot-version=v4.1
MGLSSFPGAAEGVLPVLVMNTVLSVALLKSMVRSVLQLVVGANWTPPDYEEEPDEYRRENARERRISITQFKSLNQNDGGARNSAMECCVCLCGFEAEEE
VSELSCKHFFHRGCLDKWFDNIHATCPLCRSNL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67856 RING/U-box superfamily protein... Potri.010G047100 0 1
Potri.015G001700 3.60 0.9007
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Potri.004G101950 5.91 0.8761
AT2G13570 CCAAT NF-YB7 "nuclear factor Y, subunit B7"... Potri.007G103901 8.83 0.8907
AT5G66900 Disease resistance protein (CC... Potri.007G038700 12.84 0.8562
AT1G64660 ATMGL methionine gamma-lyase (.1) Potri.003G146600 13.78 0.8775
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 14.07 0.8768
AT5G42720 Glycosyl hydrolase family 17 p... Potri.014G183000 17.20 0.8731
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G183500 18.16 0.8707
AT5G55980 serine-rich protein-related (.... Potri.001G371400 19.89 0.8515
AT4G38190 ATCSLD4 ARABIDOPSIS THALIANA CELLULOSE... Potri.009G170000 21.49 0.8572 ATCSLD4.1

Potri.010G047100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.