Plant FIBer expression Database

Potri.010G052900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01130 48 / 5e-08 ATCG01130.1, YCF1.2 Ycf1 protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G052900.1 pacid=42797387 polypeptide=Potri.010G052900.1.p locus=Potri.010G052900 ID=Potri.010G052900.1.v4.1 annot-version=v4.1
ATGAAAGATCTGAATGCCAGAACAAAGACAATAAGAAATCAAATAGAAAAAATTACAAAAGAAAAGAAAAAACGATTTCTAATCTCAGAAAGAAATATTA
GTCCTAACAAACTAAGTTATAATGCTAAAAGATTAAAATTAAAATCATCAAAAAATATTTTACAGATATTAAAAAGAAACAATGCTCAATTAGTCCGTAA
ATCATATTTTTTTATCCTACAAATATATCGAGATAAATAA
AA sequence
>Potri.010G052900.1 pacid=42797387 polypeptide=Potri.010G052900.1.p locus=Potri.010G052900 ID=Potri.010G052900.1.v4.1 annot-version=v4.1
MKDLNARTKTIRNQIEKITKEKKKRFLISERNISPNKLSYNAKRLKLKSSKNILQILKRNNAQLVRKSYFFILQIYRDK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.010G052900
[exp]
0 1
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.005G154674
[exp]
6.48 0.9851
Potri.005G150475
[exp]
8.71 0.9787
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.013G075166
[exp]
8.94 0.9796
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301
[exp]
9.38 0.9832
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G136466
[exp]
12.24 0.9820
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.005G154300
[exp]
12.96 0.9820
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.013G137688
[exp]
13.26 0.9819
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.011G074401
[exp]
15.29 0.9816
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.005G150450
[exp]
20.12 0.9504
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.013G075232
[exp]
22.36 0.9725

Potri.010G052900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.