Plant FIBer expression Database

Potri.010G053600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67700 315 / 5e-110 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011383
[exp]
295 / 6e-102 AT1G67700 308 / 6e-107 unknown protein
Lus10006442
[exp]
291 / 5e-100 AT1G67700 302 / 1e-104 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G053600.6 pacid=42797651 polypeptide=Potri.010G053600.6.p locus=Potri.010G053600 ID=Potri.010G053600.6.v4.1 annot-version=v4.1
ATGGAGGTGGGCATGTCTCTAAACGCTCTGGTTAGGCTTCCGTCATCAAGAACAATGTTACTGCACGAAGATGGAGGAGGGTTACTCAAGCACACACTCT
TCTCTACTAGGAAGTCGACGGCGCAAACATCTCCAAAGAAGCAAGGCCAAGGCCACATGTTACTGGTTGTTAAAGCCAAAGGAAAGAAAGGAATGCAAAC
ACGTCAGTTTCAAAGACCACCTCCAACACTTTCCTTGCCCAAGATTGAAGATGATGGCAACCCCAAATTTCTTATCTTCATTCGCGTGGCCAATGTTTAT
CTATGGTACCCGCTTAGTCTTATAACAGGTGGTACCACTGCCAAAATCATGGTTGCTGCCAAAGATAATTTTCTGGGAAAGTACATCTACAAAGATACTC
TTGCTCGAAATCTTGCTGCAGTTATTTACAAAGATGAGAAGGAGATACAGAAAACAGCATTTAAGCAGCATCGAGTATTGCGGTCGGCAACTGAATTCAG
ATATGGTTACAAGCTCGTTGAAAATGGTAACTTGAGAGCTGCTCTTTCCATAACGGATGTCATTGAGCTTCCAACTCAAGACAAACTAAAAACAGTGCTT
GATAAAGTGAAAGACTTCTTTGGCGATGCAAAAGAATCTTTTGGGAAGCTTACAGCACTAAACTCAACTGCAACTGAAGAAGAAGAAGTTTCAAAAGAAA
AGGCCAACGTATGTTAG
AA sequence
>Potri.010G053600.6 pacid=42797651 polypeptide=Potri.010G053600.6.p locus=Potri.010G053600 ID=Potri.010G053600.6.v4.1 annot-version=v4.1
MEVGMSLNALVRLPSSRTMLLHEDGGGLLKHTLFSTRKSTAQTSPKKQGQGHMLLVVKAKGKKGMQTRQFQRPPPTLSLPKIEDDGNPKFLIFIRVANVY
LWYPLSLITGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNLRAALSITDVIELPTQDKLKTVL
DKVKDFFGDAKESFGKLTALNSTATEEEEVSKEKANVC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67700 unknown protein Potri.010G053600
[exp]
0 1
AT3G55800 SBPASE sedoheptulose-bisphosphatase (... Potri.008G063800
[exp]
1.73 0.9847
AT3G21750 UGT71B1 UDP-glucosyl transferase 71B1 ... Potri.016G016000
[exp]
2.44 0.9836
AT5G17670 alpha/beta-Hydrolases superfam... Potri.013G070700
[exp]
2.82 0.9753
AT3G17930 unknown protein Potri.015G036500
[exp]
3.31 0.9719
AT5G45930 CHLI-2, CHLI2 magnesium chelatase i2 (.1) Potri.004G053400
[exp]
3.46 0.9802 Pt-CHLI1.1
AT1G64680 unknown protein Potri.001G083300
[exp]
4.24 0.9823
AT3G12930 Lojap-related protein (.1) Potri.011G142900
[exp]
5.29 0.9768
AT3G14420 Aldolase-type TIM barrel famil... Potri.011G112700
[exp]
6.32 0.9798
AT2G33450 Ribosomal L28 family (.1) Potri.008G169800
[exp]
6.70 0.9690
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Potri.006G165600
[exp]
7.61 0.9510

Potri.010G053600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.