Potri.010G054700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67670 44 / 6e-08 unknown protein
AT1G24405 38 / 2e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037061 45 / 4e-08 AT1G24405 59 / 8e-14 unknown protein
Lus10036923 44 / 6e-08 AT1G24405 61 / 2e-14 unknown protein
PFAM info
Representative CDS sequence
>Potri.010G054700.1 pacid=42796832 polypeptide=Potri.010G054700.1.p locus=Potri.010G054700 ID=Potri.010G054700.1.v4.1 annot-version=v4.1
ATGGAATCTGGGCTATCCTGGGCTGATCAATGGGATTATAACACCCCTGACCCTCCGCCGCAGTCATCGTCAAACAAAGATGACAAAAAGGGGAAGGGTG
GGAAGAAGAAGAAGAGTTTTGGCAAGAAAGTATTGAGCTTGGCATGGATGAAAGATATTCGTAAGAAATCTCAGAAATGA
AA sequence
>Potri.010G054700.1 pacid=42796832 polypeptide=Potri.010G054700.1.p locus=Potri.010G054700 ID=Potri.010G054700.1.v4.1 annot-version=v4.1
MESGLSWADQWDYNTPDPPPQSSSNKDDKKGKGGKKKKSFGKKVLSLAWMKDIRKKSQK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67670 unknown protein Potri.010G054700 0 1
AT1G47230 CYCA3;4 CYCLIN A3;4 (.1.2) Potri.008G008551 2.82 0.8933
Potri.014G092050 4.00 0.8375
Potri.003G223700 4.47 0.8665
AT3G27120 P-loop containing nucleoside t... Potri.001G331300 5.65 0.8668
AT1G54570 Esterase/lipase/thioesterase f... Potri.013G033101 7.48 0.8465
AT5G49460 ACLB-2 ATP citrate lyase subunit B 2 ... Potri.010G145766 7.74 0.8535
Potri.014G175050 7.74 0.8250
AT2G06090 Plant self-incompatibility pro... Potri.003G201300 11.91 0.6714
Potri.015G072732 12.36 0.8338
AT5G65840 Thioredoxin superfamily protei... Potri.007G007201 15.09 0.8283

Potri.010G054700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.