Potri.010G055300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48140 132 / 1e-40 B12D protein (.1)
AT3G29970 103 / 2e-29 B12D protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G179401 181 / 7e-60 AT3G48140 137 / 8e-44 B12D protein (.1)
Potri.012G074900 154 / 3e-49 AT3G48140 137 / 8e-44 B12D protein (.1)
Potri.017G098800 108 / 2e-31 AT3G29970 131 / 9e-42 B12D protein (.1)
Potri.004G117300 102 / 3e-29 AT3G29970 126 / 9e-40 B12D protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015825 157 / 2e-50 AT3G48140 150 / 3e-49 B12D protein (.1)
Lus10036977 146 / 9e-46 AT3G48140 132 / 9e-42 B12D protein (.1)
Lus10004241 141 / 2e-44 AT3G48140 132 / 4e-42 B12D protein (.1)
Lus10042151 141 / 2e-44 AT3G48140 132 / 4e-42 B12D protein (.1)
Lus10035132 103 / 3e-29 AT3G29970 112 / 5e-34 B12D protein (.1)
Lus10031971 45 / 4e-06 AT5G60335 152 / 5e-47 Thioesterase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06522 B12D NADH-ubiquinone reductase complex 1 MLRQ subunit
Representative CDS sequence
>Potri.010G055300.2 pacid=42799684 polypeptide=Potri.010G055300.2.p locus=Potri.010G055300 ID=Potri.010G055300.2.v4.1 annot-version=v4.1
ATGGTTGGTGGGGTTTTGCTGATCATTCTTGACCTATCCTTTTTCCTTTGGGCACCCACTCTTTTCCTGAATTTTAGGCGTTTCTATCCACTACAAATTC
TCTCAATATCAATCACTTCCCTTTCATACTCTCCTTTCCTTCATTTCTCTCTAAACTTGATTTTTCTGGAGAAGGGGATTTCTCTGTTTCTCCTTCTCTC
TTGCAATTCTAGCATGGCTCCCTCACGATGGATAAGGCCTGAGGTGTTTCCACTCTTTGCATCTGTTGGTGTAGCTGTTGGCATTTGTGGCATGCAACTT
CTTAGGAATATAACCACCAACCCTGAAGTAAGGGTGACGAAAGAGAACAGGGCAGCAGGAGTGCTTGACAACTTTAAAGAGGGCGAGAAATATGCAGAAC
ATGGTCTTAGGAAGTATGTCCGAAAGAGAACTCCTCAGATCATGCCATCCATCAACGGTTTCTTCTCAGACCCAGATCTTCCAACTAACTAA
AA sequence
>Potri.010G055300.2 pacid=42799684 polypeptide=Potri.010G055300.2.p locus=Potri.010G055300 ID=Potri.010G055300.2.v4.1 annot-version=v4.1
MVGGVLLIILDLSFFLWAPTLFLNFRRFYPLQILSISITSLSYSPFLHFSLNLIFLEKGISLFLLLSCNSSMAPSRWIRPEVFPLFASVGVAVGICGMQL
LRNITTNPEVRVTKENRAAGVLDNFKEGEKYAEHGLRKYVRKRTPQIMPSINGFFSDPDLPTN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G48140 B12D protein (.1) Potri.010G055300 0 1
AT5G06410 DNAJ heat shock N-terminal dom... Potri.006G200900 2.00 0.8208
AT5G48970 Mitochondrial substrate carrie... Potri.010G024100 3.74 0.8200
AT1G08710 F-box family protein (.1.2) Potri.013G067600 6.70 0.8151
AT3G11900 ANT1 aromatic and neutral transport... Potri.016G064500 7.87 0.7431 Pt-ANT1.2
AT5G46630 Clathrin adaptor complexes med... Potri.001G143800 11.35 0.7295
AT5G10830 S-adenosyl-L-methionine-depend... Potri.005G067500 12.40 0.8006
AT5G16520 unknown protein Potri.013G087400 12.64 0.7922
AT1G48040 Protein phosphatase 2C family ... Potri.010G151500 13.26 0.7005
AT4G18100 Ribosomal protein L32e (.1) Potri.011G078200 13.41 0.8066 RPL32.1
AT2G30620 winged-helix DNA-binding trans... Potri.008G162300 16.97 0.7873

Potri.010G055300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.