Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14280 72 / 5e-16 GeBP DNA-binding storekeeper protein-related (.1) AT3G25950 50 / 2e-08 TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein (.1) AT3G27270 45 / 1e-06 TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G178800 [exp] 94 / 1e-24 AT3G25950 266 / 3e-90 TRAM, LAG1 and CLN8 (TLC) lipid-sensing domain containing protein (.1) Potri.001G335100 [exp] 51 / 7e-09 AT5G14280 333 / 6e-112 DNA-binding storekeeper protein-related (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036981 [exp] 64 / 2e-13 AT5G14280 243 / 9e-81 DNA-binding storekeeper protein-related (.1) Lus10014607 [exp] 51 / 1e-08 AT5G14280 311 / 3e-103 DNA-binding storekeeper protein-related (.1) Lus10032075 [exp] 45 / 2e-06 AT5G14280 197 / 3e-60 DNA-binding storekeeper protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G056000.2 pacid=42798471 polypeptide=Potri.010G056000.2.p locus=Potri.010G056000 ID=Potri.010G056000.2.v4.1 annot-version=v4.1 ATGGGTACTCCACTTCTCCAGTGTCCAACCCTACTCATACTCTTTCTTTTGTTTCTTCTCTCCACGTATTTTTTAGCTTATTTTGTTATTCTTCGAAACT GGGAACCAAAACAGCGAAAAGAAGCTTCGAGCTGCTTCACGTCCCTTGCTCATCATGGCAGTCCTGCGGTTATTATGGCTGTCCGTGCAGTACTGCTACA CAGCCAAACCTCACTTACCTTTGCCTCTCCAAACTCAGCTTACGATAACACAATGCTTGAGCTCAGCATGGCTTTAGTTCTTGGTGGACCTCCTTCACTA CATGGCATTCTTCCCTAA
AA sequence Show only first row Show all	>Potri.010G056000.2 pacid=42798471 polypeptide=Potri.010G056000.2.p locus=Potri.010G056000 ID=Potri.010G056000.2.v4.1 annot-version=v4.1 MGTPLLQCPTLLILFLLFLLSTYFLAYFVILRNWEPKQRKEASSCFTSLAHHGSPAVIMAVRAVLLHSQTSLTFASPNSAYDNTMLELSMALVLGGPPSL HGILP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G14280	GeBP		DNA-binding storekeeper protei...		Potri.010G056000 [exp]	0	1
AT1G58122		CPuORF45	conserved peptide upstream ope...		Potri.007G113150 [exp]	1.41	0.9756
AT2G27228		CPuORF6	conserved peptide upstream ope...		Potri.001G216800 [exp]	2.00	0.9732
					Potri.010G080633 [exp]	2.44	0.9519
AT2G16880			Pentatricopeptide repeat (PPR)...		Potri.008G044050 [exp]	3.87	0.9371
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.002G177032 [exp]	3.87	0.8584
AT5G52552		CPuORF14	conserved peptide upstream ope...		Potri.017G143300 [exp]	4.00	0.9190
					Potri.005G187000 [exp]	4.24	0.9347
AT3G25970			Pentatricopeptide repeat (PPR)...		Potri.017G001050 [exp]	5.29	0.8586
AT2G31280	bHLH	bHLH155 ,CPuORF...	conserved peptide upstream ope...		Potri.006G090033 [exp]	5.29	0.9343
AT5G36930			Disease resistance protein (TI...		Potri.010G231250 [exp]	5.74	0.8928

Compare expression of checked genes

Potri.010G056000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.