Potri.010G056600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67600 254 / 6e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT1G24350 247 / 1e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
AT3G21610 207 / 8e-69 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
AT3G61770 135 / 3e-39 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
AT3G12685 87 / 3e-21 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G087100 205 / 2e-68 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.014G156000 184 / 8e-60 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G226900 178 / 1e-57 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Potri.002G171300 141 / 1e-41 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Potri.010G176100 71 / 6e-15 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011373 263 / 4e-91 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10006432 262 / 1e-90 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10036984 207 / 1e-69 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3)
Lus10035299 201 / 2e-66 AT3G21610 275 / 1e-95 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10000883 192 / 3e-63 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10003670 192 / 4e-63 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030025 187 / 4e-60 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Lus10030253 134 / 1e-40 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001756 77 / 5e-17 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
Lus10001841 77 / 6e-17 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF02681 DUF212 Divergent PAP2 family
Representative CDS sequence
>Potri.010G056600.1 pacid=42800281 polypeptide=Potri.010G056600.1.p locus=Potri.010G056600 ID=Potri.010G056600.1.v4.1 annot-version=v4.1
ATGGTTGAGATGGCTACTGGGTCGTCGACGACGACGATCCAAAACTCGGGGGCTTCTTTATCGTCGTCGGAGTCAAGATTGACGAATTATCCACTGATCT
CTGCATTTCTTGCCTTCGCTATTGCCCAATCTATCAAGTTTTTCACCTCCTGGTATAAGGAAAGACGATGGGATCTTAAGCAACTAGTTGGATCTGGTGG
GATGCCATCCTCACATTCTGCTACAGTTGCTGCTCTTGCCATGGCCGTTGGATTCCAAGAGGGCTTCGGAGGATCGTTGTTTTCGATTGCATTGATATTA
GCATGCGTTGTGATGTATGATGCAACAGGTGTAAGACTACAGGCTGGACGCCAAGCAGAGGTCCTGAATCAAATCCTGTATGAACTCCCTGCTGAACATC
CTCTTTCTGACAGCAGACCGCTGCGTGAACTTCTTGGGCACACCCCGCCTCAGGTTATTGCTGGCGGTTTGCTTGGTCTTGTCACAGCAGTTATTGGCCA
TCTGATCACGATCCTGACAACTAGTCGAAGTTGA
AA sequence
>Potri.010G056600.1 pacid=42800281 polypeptide=Potri.010G056600.1.p locus=Potri.010G056600 ID=Potri.010G056600.1.v4.1 annot-version=v4.1
MVEMATGSSTTTIQNSGASLSSSESRLTNYPLISAFLAFAIAQSIKFFTSWYKERRWDLKQLVGSGGMPSSHSATVAALAMAVGFQEGFGGSLFSIALIL
ACVVMYDATGVRLQAGRQAEVLNQILYELPAEHPLSDSRPLRELLGHTPPQVIAGGLLGLVTAVIGHLITILTTSRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67600 Acid phosphatase/vanadium-depe... Potri.010G056600 0 1
AT1G10660 unknown protein Potri.010G042600 3.00 0.7936
AT4G24290 MAC/Perforin domain-containing... Potri.003G006500 4.35 0.8078
AT1G55170 unknown protein Potri.003G037900 7.07 0.7727
AT3G26922 F-box/RNI-like superfamily pro... Potri.011G104100 12.96 0.7697
AT2G35900 unknown protein Potri.016G066800 15.58 0.7281
AT1G31480 SGR2 shoot gravitropism 2 (SGR2) (.... Potri.019G072300 17.72 0.7945 Pt-SGR2.2
AT3G12040 DNA-3-methyladenine glycosylas... Potri.016G060000 24.89 0.7762
AT4G13630 Protein of unknown function, D... Potri.002G242900 32.84 0.7475
AT1G77840 Translation initiation factor ... Potri.004G093600 41.47 0.7593
AT1G45976 SBP1 S-ribonuclease binding protein... Potri.014G027000 44.03 0.7684 SBP1.3

Potri.010G056600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.