Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57810 52 / 2e-09 Cysteine proteinases superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G177400 [exp] 89 / 5e-24 AT3G57810 223 / 6e-74 Cysteine proteinases superfamily protein (.1.2.3) Potri.016G050900 [exp] 56 / 8e-11 AT3G57810 301 / 5e-101 Cysteine proteinases superfamily protein (.1.2.3) Potri.006G057400 [exp] 51 / 4e-09 AT3G57810 308 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3) Potri.008G026100 [exp] 46 / 2e-07 AT3G57810 197 / 2e-61 Cysteine proteinases superfamily protein (.1.2.3) Potri.010G234300 [exp] 44 / 2e-06 AT3G57810 195 / 9e-61 Cysteine proteinases superfamily protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015803 [exp] 59 / 1e-12 AT3G57810 215 / 3e-71 Cysteine proteinases superfamily protein (.1.2.3) Lus10037002 [exp] 59 / 2e-12 AT3G57810 213 / 2e-70 Cysteine proteinases superfamily protein (.1.2.3) Lus10020438 [exp] 46 / 2e-07 AT3G57810 290 / 3e-97 Cysteine proteinases superfamily protein (.1.2.3) Lus10028840 [exp] 45 / 9e-07 AT3G57810 194 / 4e-59 Cysteine proteinases superfamily protein (.1.2.3) Lus10008986 [exp] 43 / 4e-06 AT3G57810 187 / 9e-58 Cysteine proteinases superfamily protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G057750.1 pacid=42797144 polypeptide=Potri.010G057750.1.p locus=Potri.010G057750 ID=Potri.010G057750.1.v4.1 annot-version=v4.1 ATGTTACTTAAAGGAATATCGATGTCATACATTTTTTTCTTTTCTAGGATGCCAAACACTGTATACATGAGAGATAAAAGTTCCGGTAGCCTTAAAATTA TAGCTGAATACGGTCAAGATTATGGTAATGAGAATCAAGATTATCATGGTTACGGGCACTATGATGCACCGCCCAGTGTGATAGGTGGTGCGCCACCCAA GCAGTCCAAGAAAAGATGA
AA sequence Show only first row Show all	>Potri.010G057750.1 pacid=42797144 polypeptide=Potri.010G057750.1.p locus=Potri.010G057750 ID=Potri.010G057750.1.v4.1 annot-version=v4.1 MLLKGISMSYIFFFSRMPNTVYMRDKSSGSLKIIAEYGQDYGNENQDYHGYGHYDAPPSVIGGAPPKQSKKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G57810			Cysteine proteinases superfami...		Potri.010G057750 [exp]	0	1
AT5G07900			Mitochondrial transcription te...		Potri.009G021701 [exp]	2.00	0.8510
AT3G60130		BGLU16	beta glucosidase 16 (.1.2.3)		Potri.001G226200 [exp]	6.92	0.8489	Pt-PLIN-GEN.19
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Potri.001G205200 [exp]	8.71	0.8475	Pt-PIN2.1,PIN10
AT1G13330		AHP2	Arabidopsis Hop2 homolog (.1)		Potri.010G127101 [exp]	8.94	0.8050
AT3G30387			Protein of unknown function (D...		Potri.017G029250 [exp]	13.07	0.8026
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Potri.015G100102 [exp]	14.73	0.8100
AT5G24550		BGLU32	beta glucosidase 32 (.1)		Potri.001G225812 [exp]	15.87	0.7967
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.002G050500 [exp]	16.12	0.8001
AT5G05960			Bifunctional inhibitor/lipid-t...		Potri.010G196300 [exp]	20.71	0.7988
					Potri.005G023301 [exp]	20.78	0.7930

Compare expression of checked genes

Potri.010G057750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.