Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PBE1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G13060 439 / 2e-157 PBE1 20S proteasome beta subunit E1 (.1.2) AT4G31300 95 / 2e-23 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT5G40580 84 / 1e-18 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 82 / 3e-18 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT1G53850 70 / 4e-14 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT3G14290 69 / 1e-13 PAE2 20S proteasome alpha subunit E2 (.1) AT4G14800 56 / 2e-09 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G22630 56 / 5e-09 PRCGB, PBD1 20S proteasome beta subunit D1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G177000 [exp] 530 / 0 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.006G077900 [exp] 93 / 3e-22 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.018G145900 [exp] 88 / 2e-20 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.017G071100 [exp] 82 / 6e-18 AT5G40580 497 / 1e-180 20S proteasome beta subunit PBB2 (.1.2.3) Potri.004G066000 [exp] 81 / 1e-17 AT3G27430 495 / 1e-179 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.001G162900 [exp] 70 / 4e-14 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.003G072500 [exp] 69 / 1e-13 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.010G084800 [exp] 58 / 6e-10 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.008G155500 [exp] 54 / 1e-08 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011369 [exp] 464 / 2e-167 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10006426 [exp] 456 / 3e-164 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10020180 [exp] 92 / 4e-22 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10032102 [exp] 85 / 5e-19 AT3G27430 473 / 6e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10014581 [exp] 85 / 5e-19 AT5G40580 471 / 2e-169 20S proteasome beta subunit PBB2 (.1.2.3) Lus10026984 [exp] 84 / 2e-18 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10003936 [exp] 68 / 1e-12 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 68 / 1e-12 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10039351 [exp] 53 / 4e-08 AT3G22630 371 / 5e-133 20S proteasome beta subunit D1 (.1) Lus10002599 [exp] 52 / 2e-07 AT4G05020 630 / 0.0 NAD(P)H dehydrogenase B2 (.1), NAD(P)H dehydrogenase B2 (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [poplar] [flax] NTN PF00227 [poplar] [flax] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Potri.010G058100.11 pacid=42800205 polypeptide=Potri.010G058100.11.p locus=Potri.010G058100 ID=Potri.010G058100.11.v4.1 annot-version=v4.1 ATGAAGTTTGATACTAGTGGTCTCGAATCCACTTCTTCGGTCTTTGGAACGGCCGGTAGGGAGCTTGTTGATGGGTTTTCTGCTGCTGCTGCTCCAGCTT TTGAGCTACCCACGACTAAGGATTTTGATGGCTTCCAGAAGGAAGCTGTACAGATGGTGAAGCCGGCTAAGGGGACAACTACGCTGGCCTTTATCTTTAA GGAGGGTGTCATTGTTGCAGCTGATTCTCGTGCTAGCATGGGGGGCTATATTTCATCACAGTCAGTTAAAAAAATCATTGAAATCAATCCCTACATGCTT GGTACAATGGCTGGTGGAGCTGCTGATTGCCAGTTTTGGCACAGAAATTTGGGCATTAAGTGCCGACTACATGAATTGGCAAACAAGCGTAGAATTTCAG TTACAGGGGCATCAAAGCTTCTGGCAAACATTCTGTTCTCTTACCGTGGAATGGGCTTGTCTGTTGGGACAATGATTGCTGGTTGGGATGAAACGGGTCC TGGACTATATTATGTGGACAGTGAAGGTGGAAGGCTGAAAGGAACAAGATTCTCTGTTGGATCTGGTTCTCCATATGCATATGGTATACTGGATAGTGGG TACCGATTTGATATGTCAATTGAAGAAGCTGCAGAGTTAGGTAGAAGAGCTATTTATCATGCAACGTTCCGTGATGGGGCCAGTGGTGGAGTTGCAAGCG TTTATTATGTGGGAGCAAATGGATGGACGAAACTATCTGGCGATGATGTCTCAGAGCTCCACTACAAATACTATCCAGTTGTGTCAGCTGAAACTTCAGA GCCGGACCAGATGGTTGAAGCATAA
AA sequence Show only first row Show all	>Potri.010G058100.11 pacid=42800205 polypeptide=Potri.010G058100.11.p locus=Potri.010G058100 ID=Potri.010G058100.11.v4.1 annot-version=v4.1 MKFDTSGLESTSSVFGTAGRELVDGFSAAAAPAFELPTTKDFDGFQKEAVQMVKPAKGTTTLAFIFKEGVIVAADSRASMGGYISSQSVKKIIEINPYML GTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILFSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGILDSG YRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKYYPVVSAETSEPDQMVEA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26340			N-terminal nucleophile aminohy...		Potri.010G058100 [exp]	0	1	PBE1.1
AT5G05780		RPN8A, AE3, ATH...	ASYMMETRIC LEAVES ENHANCER 3, ...		Potri.008G065200 [exp]	1.00	0.9213
AT3G51260		PAD1	20S proteasome alpha subunit ...		Potri.004G174200 [exp]	1.41	0.8835	Pt-PAD1.2
AT2G17420		NTR2, ATNTRA, N...	NADPH-DEPENDENT THIOREDOXIN RE...		Potri.001G456800 [exp]	3.46	0.8701
AT3G60820		PBF1	N-terminal nucleophile aminohy...		Potri.002G148300 [exp]	4.24	0.8418	Pt-PBF1.1
AT1G05350			NAD(P)-binding Rossmann-fold s...		Potri.015G096300 [exp]	4.69	0.8383
AT1G20200		HAP15, EMB2719	HAPLESS 15, EMBRYO DEFECTIVE 2...		Potri.004G176600 [exp]	6.70	0.8536
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.006G216600 [exp]	7.48	0.8636	RPT1.5
AT1G45000			AAA-type ATPase family protein...		Potri.002G031400 [exp]	8.48	0.8369	RPT4.2
AT5G23540			Mov34/MPN/PAD-1 family protein...		Potri.002G127900 [exp]	8.94	0.8614
AT2G27020		PAG1	20S proteasome alpha subunit G...		Potri.001G224100 [exp]	9.74	0.8416	Pt-PAG1.1

Compare expression of checked genes

Potri.010G058100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.