Potri.010G058300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20165 129 / 3e-41 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G176801 143 / 6e-47 AT5G20165 128 / 4e-41 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003197 132 / 1e-39 AT1G64520 335 / 5e-116 regulatory particle non-ATPase 12A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06842 DUF1242 Protein of unknown function (DUF1242)
Representative CDS sequence
>Potri.010G058300.6 pacid=42799489 polypeptide=Potri.010G058300.6.p locus=Potri.010G058300 ID=Potri.010G058300.6.v4.1 annot-version=v4.1
ATGTCTGCACTGTTCAATTTCCATTCGTTTCTGACAGTGGTGCTGTTGGGGATTTGTACATGCACATTTGTGAAGATGCACTTTCCAGCAATCCTTGAAC
AGAGAAATGGATTTCGTGGTTTCTTTTGGAAGGCAGCTAGAATAGGTGAACGTTTGAGCCCCTGGGTTGCTGTAGGATGCTTCACGATGGGCGTGTCGAT
AATCTTTTTCTGA
AA sequence
>Potri.010G058300.6 pacid=42799489 polypeptide=Potri.010G058300.6.p locus=Potri.010G058300 ID=Potri.010G058300.6.v4.1 annot-version=v4.1
MSALFNFHSFLTVVLLGICTCTFVKMHFPAILEQRNGFRGFFWKAARIGERLSPWVAVGCFTMGVSIIFF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G20165 unknown protein Potri.010G058300 0 1
AT3G51040 RTH RTE1-homolog (.1.2.3) Potri.007G017900 1.41 0.9133
AT1G51650 ATP synthase epsilon chain, mi... Potri.008G008900 2.00 0.9147
AT1G57765 unknown protein Potri.004G226100 2.44 0.9125
AT4G32530 ATPase, F0/V0 complex, subunit... Potri.006G248700 4.00 0.9117
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.009G028200 7.74 0.8981 Pt-ADF1.1
AT4G20410 GAMMA-SNAP, GSN... gamma-soluble NSF attachment p... Potri.011G155200 9.94 0.8682 Pt-GSNAP.1
AT1G05720 selenoprotein family protein (... Potri.013G126900 10.39 0.8532
Potri.001G129500 12.04 0.8014
AT5G57815 Cytochrome c oxidase, subunit ... Potri.018G099900 16.52 0.8717
AT1G32050 SCAMP family protein (.1) Potri.003G099300 17.08 0.8219

Potri.010G058300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.