Potri.010G058400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G176700 162 / 3e-52 ND /
Potri.010G058600 91 / 2e-24 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006424 103 / 2e-29 ND /
Lus10011367 102 / 9e-29 ND /
Lus10037007 96 / 3e-26 ND /
Lus10015798 94 / 8e-26 ND /
PFAM info
Representative CDS sequence
>Potri.010G058400.2 pacid=42797476 polypeptide=Potri.010G058400.2.p locus=Potri.010G058400 ID=Potri.010G058400.2.v4.1 annot-version=v4.1
ATGTCTCTACTCCCAGAATCATCCTGTCCTCTGTTGACAATTCTCTCCCTCTCCCCCAGCCACCCTACTCTCATTATTTCTCAATGCAATCCTATAAAAG
CCAGCTTTGCAATCAGTAACATCATAAGCATGGATTGCAAAGATATGGAGGAAAATGGGACGGGGATGAGGACAAGGAGCTTCCGTGATGAAGATTACAT
CAACAGAAGGGCATTTTTGAGAAGCTATCCTCTTTATCACGGAGCAGAAGATGAGACAACCAATGAAGAGATGATCGGTGCCACAAACAAGGAAACTGAG
AAGAAACCCATAAAGAGGATGATCATATCAGTAACTCATTGGGGTGAAGGGAAGGTTCTAGTACTGAGGAAATTCAAGCATAAGATCCAGGTTTATATCA
TAGCTTGTATGCCTGTCAGCTTTAAGCCCCCTACGGCCCTAATTTCAGTTTAA
AA sequence
>Potri.010G058400.2 pacid=42797476 polypeptide=Potri.010G058400.2.p locus=Potri.010G058400 ID=Potri.010G058400.2.v4.1 annot-version=v4.1
MSLLPESSCPLLTILSLSPSHPTLIISQCNPIKASFAISNIISMDCKDMEENGTGMRTRSFRDEDYINRRAFLRSYPLYHGAEDETTNEEMIGATNKETE
KKPIKRMIISVTHWGEGKVLVLRKFKHKIQVYIIACMPVSFKPPTALISV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G058400 0 1
AT4G22320 unknown protein Potri.004G001500 10.24 0.6245
AT1G07080 Thioredoxin superfamily protei... Potri.006G103000 16.43 0.7135
AT2G01600 ENTH/ANTH/VHS superfamily prot... Potri.010G110000 16.91 0.6919
AT3G01435 Expressed protein (.1) Potri.004G001600 19.49 0.7219
AT1G79450 ALIS5 ALA-interacting subunit 5 (.1.... Potri.001G381500 20.32 0.7116
AT1G73350 unknown protein Potri.004G066700 20.49 0.7097
AT5G63220 unknown protein Potri.008G044100 21.07 0.7486
AT5G58030 Transport protein particle (TR... Potri.006G187300 21.44 0.6963
AT5G53000 TAP46 2A phosphatase associated prot... Potri.015G012200 21.90 0.6782
AT1G56050 GTP-binding protein-related (.... Potri.011G143700 26.94 0.7083

Potri.010G058400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.