Potri.010G058600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G058400 79 / 1e-19 ND /
Potri.008G176700 77 / 4e-19 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015798 50 / 3e-09 ND /
Lus10037007 38 / 0.0002 ND /
PFAM info
Representative CDS sequence
>Potri.010G058600.2 pacid=42796901 polypeptide=Potri.010G058600.2.p locus=Potri.010G058600 ID=Potri.010G058600.2.v4.1 annot-version=v4.1
ATGGCCTCAAAGCTGATCTGGAGCTTATGCTTTCCGCAGCAACAGAACCTTTCCTTCACTTCAGTTTATCCTCTTCACGGGTTTATTCTCAGTGTTCTTG
TTAGTGGCGCTGACCATCTCTTCAGTGATTGTCTTGTCTGCTGCTCCACAATGAAGAGGATAGCTCCTCAAGAATACCCTTCTGTTATTGTAGTCTTCAT
GGTGGACACTCCTCATCTTCAACCCATGTTCTACTATTTCTTTGCAATCCATACTTTCAGAAGCACTAGTGATTTCTGCACAATGGTGGCTTTTATGGGA
TTGTGGAGGAGAAAGTTGGGATAG
AA sequence
>Potri.010G058600.2 pacid=42796901 polypeptide=Potri.010G058600.2.p locus=Potri.010G058600 ID=Potri.010G058600.2.v4.1 annot-version=v4.1
MASKLIWSLCFPQQQNLSFTSVYPLHGFILSVLVSGADHLFSDCLVCCSTMKRIAPQEYPSVIVVFMVDTPHLQPMFYYFFAIHTFRSTSDFCTMVAFMG
LWRRKLG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G058600 0 1
AT3G21215 RNA-binding (RRM/RBD/RNP motif... Potri.010G249700 2.44 0.8431
AT1G20950 Phosphofructokinase family pro... Potri.006G024500 5.09 0.8438
AT2G35320 ATEYA EYES ABSENT homolog (.1) Potri.001G144000 5.91 0.8290
AT5G20510 Alfin AL5 alfin-like 5 (.1) Potri.018G050200 6.70 0.8198
AT2G24030 zinc ion binding;nucleic acid ... Potri.006G182601 8.71 0.7984
AT2G48100 C2H2ZnF Exonuclease family protein (.1... Potri.002G215700 8.83 0.8291
AT4G27130 Translation initiation factor ... Potri.011G134700 9.48 0.8295
AT1G22270 Trm112p-like protein (.1) Potri.002G096600 10.00 0.8143
AT4G14540 CCAAT NF-YB3 "nuclear factor Y, subunit B3"... Potri.014G167800 16.49 0.8307
AT4G02510 TOC86, TOC160, ... TRANSLOCON AT THE OUTER ENVELO... Potri.008G225000 16.52 0.8097

Potri.010G058600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.