Potri.010G060400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67430 296 / 4e-104 Ribosomal protein L22p/L17e family protein (.1.2)
AT1G27400 293 / 5e-103 Ribosomal protein L22p/L17e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G175500 315 / 9e-112 AT1G67430 285 / 1e-99 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.015G094400 311 / 4e-110 AT1G67430 324 / 4e-115 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.012G096600 311 / 8e-110 AT1G27400 321 / 4e-114 Ribosomal protein L22p/L17e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006421 291 / 5e-102 AT1G67430 315 / 1e-111 Ribosomal protein L22p/L17e family protein (.1.2)
Lus10015792 262 / 5e-83 AT1G67420 511 / 2e-168 Zn-dependent exopeptidases superfamily protein (.1.2)
Lus10037015 261 / 1e-81 AT1G67420 1104 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Representative CDS sequence
>Potri.010G060400.1 pacid=42799023 polypeptide=Potri.010G060400.1.p locus=Potri.010G060400 ID=Potri.010G060400.1.v4.1 annot-version=v4.1
ATGGTGAAGTACTCTAGAGAGCCTGATAACCCCACCAAATCTTGCAAGGCAAGGGGCTCTGACCTCAGAGTTCACTTCAAGAATACAAGAGAGACAGCTT
TTGCTCTAAGGAAGTTGCCTCTGGTCAAGGCCAAGAGGTATTTGGAAGATGTTATGGCTCACAAACAGGCCATTCCATTCCGACGTTTCTGTGGTGGAGT
TGGGCGTACTGCACAAGCAAAGAACAGGCACTCTAATGGACAAGGACGATGGCCTGCCAAGTCTGCTAAGTTCATCTTGGATTTACTCAAGAATGCCGAG
AGCAATGCTGAGGTCAAGGGTTTGGATGTGGATGCACTCTACATTACTCACATCCAGGTGAATCAGGCACAGAAGCAGAGACGTCGTACTTATCGGGCGC
ATGGAAGAATTAATCCTTACATGTCCAGCCCTTGCCACATTGAGTTGACTTTATCTGAAAAGGAAGAGCCAGTTAAGAAAGAGCCTGAGACCCAGCTAGC
AACCAGCAAGTCAAAGAAGTCTCAAGCCTCCTCTTGA
AA sequence
>Potri.010G060400.1 pacid=42799023 polypeptide=Potri.010G060400.1.p locus=Potri.010G060400 ID=Potri.010G060400.1.v4.1 annot-version=v4.1
MVKYSREPDNPTKSCKARGSDLRVHFKNTRETAFALRKLPLVKAKRYLEDVMAHKQAIPFRRFCGGVGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAE
SNAEVKGLDVDALYITHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEPETQLATSKSKKSQASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.010G060400 0 1
AT2G47110 UBQ6 ubiquitin 6 (.1.2) Potri.002G190000 1.41 0.9213
AT5G59850 Ribosomal protein S8 family pr... Potri.010G208700 2.00 0.9149 Pt-WRP15.1
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Potri.014G192601 2.00 0.9080
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Potri.001G311000 2.64 0.8893
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.001G295902 4.24 0.8865
AT1G26880 Ribosomal protein L34e superfa... Potri.012G108400 6.00 0.8938 RPL34.4
AT5G50375 CPI1 cyclopropyl isomerase (.1.2) Potri.015G093500 9.38 0.8282
AT3G05590 RPL18 ribosomal protein L18 (.1) Potri.002G202800 9.79 0.8755 RPL18.9
AT5G61170 Ribosomal protein S19e family ... Potri.004G118800 11.09 0.9113 RPS19.1
AT5G20920 EIF2 BETA, EMB1... embryo defective 1401, eukaryo... Potri.019G131200 12.24 0.8780 EIF2.2

Potri.010G060400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.