Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29450 106 / 2e-30 ATGSTU1, AT103-1A, ATGSTU5 ARABIDOPSIS THALIANA GLUTATHIONE S-TRANSFERASE TAU 1, glutathione S-transferase tau 5 (.1) AT1G74590 106 / 3e-30 ATGSTU10 glutathione S-transferase TAU 10 (.1) AT2G29420 103 / 3e-29 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) AT2G29440 100 / 8e-28 GST24, ATGSTU6 GLUTATHIONE S-TRANSFERASE 24, glutathione S-transferase tau 6 (.1) AT1G78340 97 / 1e-26 ATGSTU22 glutathione S-transferase TAU 22 (.1) AT5G62480 96 / 4e-26 GST14B, ATGSTU9 GLUTATHIONE S-TRANSFERASE 14B, GLUTATHIONE S-TRANSFERASE 14, glutathione S-transferase tau 9 (.1.2) AT3G09270 93 / 4e-25 ATGSTU8 glutathione S-transferase TAU 8 (.1) AT2G29480 92 / 8e-25 GST20, ATGSTU2 GLUTATHIONE S-TRANSFERASE 20, glutathione S-transferase tau 2 (.1) AT2G29490 92 / 9e-25 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1) AT2G29460 92 / 1e-24 GST22, ATGSTU4 GLUTATHIONE S-TRANSFERASE 22, glutathione S-transferase tau 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118500 [exp] 127 / 1e-38 AT2G29420 194 / 3e-62 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061200 [exp] 126 / 5e-38 AT3G09270 202 / 8e-66 glutathione S-transferase TAU 8 (.1) Potri.008G174900 [exp] 122 / 1e-36 AT2G29420 184 / 1e-58 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061301 [exp] 120 / 7e-36 AT2G29420 202 / 9e-66 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061800 [exp] 120 / 8e-36 AT2G29420 187 / 1e-59 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.002G254000 [exp] 120 / 9e-36 AT2G29420 167 / 1e-51 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.010G061600 [exp] 120 / 1e-35 AT2G29420 172 / 7e-54 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.008G175000 [exp] 120 / 1e-35 AT2G29420 177 / 7e-56 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Potri.016G023200 [exp] 114 / 2e-33 AT3G09270 189 / 1e-60 glutathione S-transferase TAU 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035241 [exp] 110 / 9e-32 AT2G29420 188 / 5e-60 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10021102 [exp] 106 / 5e-30 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1) Lus10021103 [exp] 103 / 3e-29 AT3G09270 250 / 1e-84 glutathione S-transferase TAU 8 (.1) Lus10007897 [exp] 100 / 1e-27 AT2G29420 187 / 1e-59 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10041654 [exp] 100 / 1e-27 AT2G29420 175 / 1e-54 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10001491 [exp] 99 / 3e-27 AT3G09270 185 / 5e-59 glutathione S-transferase TAU 8 (.1) Lus10040762 [exp] 94 / 1e-26 AT2G29420 127 / 3e-38 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10040727 [exp] 97 / 2e-26 AT2G29420 216 / 6e-71 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10016468 [exp] 94 / 2e-26 AT2G29420 140 / 7e-43 GLUTATHIONE S-TRANSFERASE 25, glutathione S-transferase tau 7 (.1) Lus10007896 [exp] 96 / 3e-26 AT2G29490 171 / 2e-53 GLUTATHIONE S-TRANSFERASE 19, glutathione S-transferase TAU 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF13417 [poplar] [flax] GST_N_3 Glutathione S-transferase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.010G061500.1 pacid=42800156 polypeptide=Potri.010G061500.1.p locus=Potri.010G061500 ID=Potri.010G061500.1.v4.1 annot-version=v4.1 ATGGGTGAAGTGAAGCTGCACGGGACATGGAATGGCCCATATAGTTGGAGAGTGATTTGGGCGCTGAAACCGAAGGGCATATCGTATGAATACATAGAGG AAGATTTGCGCGATAAAAGTCCCATGCTTCTACAGCATAACCCTGTCCACAAGAAGATCCCAATGCTTGTTCATGATGGGAAACCAAATTGTGAATCCAT GGTAATCCTCGCATACATTGAAGAGACTTGGCCACAGAACCCCTTATGA
AA sequence Show only first row Show all	>Potri.010G061500.1 pacid=42800156 polypeptide=Potri.010G061500.1.p locus=Potri.010G061500 ID=Potri.010G061500.1.v4.1 annot-version=v4.1 MGEVKLHGTWNGPYSWRVIWALKPKGISYEYIEEDLRDKSPMLLQHNPVHKKIPMLVHDGKPNCESMVILAYIEETWPQNPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G74590		ATGSTU10	glutathione S-transferase TAU ...		Potri.010G061500 [exp]	0	1
					Potri.001G297101 [exp]	7.07	0.8975
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Potri.005G104900 [exp]	16.06	0.8946
AT5G39190		ATGER2, GLP2A	GERMIN-LIKE PROTEIN 2A, A. THA...		Potri.011G162200 [exp]	32.00	0.8797	GER2.33
AT3G17675			Cupredoxin superfamily protein...		Potri.013G030450 [exp]	35.70	0.8772
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.013G038901 [exp]	47.32	0.8729
AT4G18910		ATNLM2, NIP1;2,...	NOD26-LIKE INTRINSIC PROTEIN 2...		Potri.002G097000 [exp]	48.78	0.8540
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Potri.003G118800 [exp]	54.11	0.8440
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.005G051500 [exp]	55.19	0.8611
					Potri.005G061780 [exp]	60.00	0.8606
AT1G77640	AP2_ERF		Integrase-type DNA-binding sup...		Potri.002G085600 [exp]	71.23	0.8092	DREB41

Compare expression of checked genes

Potri.010G061500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.