Potri.010G062800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13560 78 / 3e-20 UNE15 unfertilized embryo sac 15, Late embryogenesis abundant protein (LEA) family protein (.1)
AT1G52690 44 / 9e-07 LEA7 LATE EMBRYOGENESIS ABUNDANT 7, Late embryogenesis abundant protein (LEA) family protein (.1), Late embryogenesis abundant protein (LEA) family protein (.2)
AT3G15670 45 / 1e-06 Late embryogenesis abundant protein (LEA) family protein (.1)
AT1G52680 43 / 2e-06 late embryogenesis abundant protein-related / LEA protein-related (.1)
AT1G15415 41 / 6e-06 unknown protein
AT5G38760 37 / 0.0001 Late embryogenesis abundant protein (LEA) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G173200 55 / 9e-11 AT1G52690 58 / 2e-11 LATE EMBRYOGENESIS ABUNDANT 7, Late embryogenesis abundant protein (LEA) family protein (.1), Late embryogenesis abundant protein (LEA) family protein (.2)
Potri.001G172900 49 / 1e-08 AT1G52680 67 / 1e-15 late embryogenesis abundant protein-related / LEA protein-related (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004395 52 / 1e-09 AT3G15670 78 / 5e-18 Late embryogenesis abundant protein (LEA) family protein (.1)
PFAM info
Representative CDS sequence
>Potri.010G062800.1 pacid=42799988 polypeptide=Potri.010G062800.1.p locus=Potri.010G062800 ID=Potri.010G062800.1.v4.1 annot-version=v4.1
ATGTCTAACATGCAGCAAAGCTTCAATGCAGGCCAAACCAAAGGCAACACCCAGGCTAAGGTAGAACAGTGGACTGAAACCATCCAGGATACAGCAAATG
CAGCCTGTAGAGACAGCACATCAGCTGGTGCTCAGTCAACCGGAGATTCTGCTCAACTAGAGAAGGATCACAGTGCTGGTTTCCTGCAGCAGACTGGAGA
GCAAGTGAAGCATGTGGCTCAGGATGCAATGGACTCTGTGAAGAACACGCTTGGTATAGGTCAGAATAAGAAATGA
AA sequence
>Potri.010G062800.1 pacid=42799988 polypeptide=Potri.010G062800.1.p locus=Potri.010G062800 ID=Potri.010G062800.1.v4.1 annot-version=v4.1
MSNMQQSFNAGQTKGNTQAKVEQWTETIQDTANAACRDSTSAGAQSTGDSAQLEKDHSAGFLQQTGEQVKHVAQDAMDSVKNTLGIGQNKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G13560 UNE15 unfertilized embryo sac 15, La... Potri.010G062800 0 1

Potri.010G062800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.