Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 137 / 3e-41 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17140 76 / 3e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17130 65 / 2e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17152 64 / 8e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 57 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 54 / 4e-09 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT5G46970 45 / 5e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46950 45 / 6e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17220 44 / 7e-06 ATPMEI2 pectin methylesterase inhibitor 2 (.1) AT5G46940 43 / 3e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083500 [exp] 145 / 1e-44 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 98 / 4e-26 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G288500 [exp] 89 / 2e-23 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.010G209800 [exp] 69 / 8e-15 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.014G044100 [exp] 65 / 3e-13 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134900 [exp] 65 / 3e-13 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G108301 [exp] 56 / 9e-10 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.001G109700 [exp] 51 / 4e-08 AT1G47960 46 / 2e-06 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.003G086600 [exp] 49 / 3e-07 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016317 [exp] 133 / 2e-39 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 128 / 9e-38 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10003530 [exp] 121 / 6e-35 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10002933 [exp] 118 / 9e-34 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017013 [exp] 116 / 5e-33 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 115 / 2e-32 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 112 / 1e-31 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037792 [exp] 97 / 2e-25 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017076 [exp] 97 / 2e-25 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10017040 [exp] 92 / 1e-23 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [poplar] [flax] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Potri.010G063000.1 pacid=42799443 polypeptide=Potri.010G063000.1.p locus=Potri.010G063000 ID=Potri.010G063000.1.v4.1 annot-version=v4.1 ATGAAGAATTCTCTGTCCCTGAGTTTCATCTTTCTTTCTCCTTCACTCTTCACCGCCACCCTTCTGCTAACAAGCCAGTGCACTATTGTCCAGTCTGCTG CCAATGATCTGATAGCACAAACATGCAAGCACACACCGTACTACAACCTCTGTGTCACTTCTCTTAAGTCTGTCCCTAAAAGCTCCGGAGCAGATGTCCA GGGGCTAGCACTCATCATGGTCGATATAGTGAGGGCTAAAGCAAGCACAGCACTGAGATTCATCAACCAGGAGCTTAAAAGGAGCCCAGGATTAAGGCGA CCTTTGAGGTTTTGTGCCAGCTGCTACGATGCAATTTTAACAGCCGACATCCCGGAAGCTATTGAAGCCCTGCAGAAGGGCGACCCTAAATTTGCTGAAA ATGGTACAAATGATGCTGCCGTTGAAGCCACTTCTTGCGAAGACGGTTTCCACGGCAAATCTCCCCTGACCAATCTGAACAGGGAAGTGCATGACACCTC AGTAGTTGCTTCTGCCATCACCAGGCTGTTACTTTGA
AA sequence Show only first row Show all	>Potri.010G063000.1 pacid=42799443 polypeptide=Potri.010G063000.1.p locus=Potri.010G063000 ID=Potri.010G063000.1.v4.1 annot-version=v4.1 MKNSLSLSFIFLSPSLFTATLLLTSQCTIVQSAANDLIAQTCKHTPYYNLCVTSLKSVPKSSGADVQGLALIMVDIVRAKASTALRFINQELKRSPGLRR PLRFCASCYDAILTADIPEAIEALQKGDPKFAENGTNDAAVEATSCEDGFHGKSPLTNLNREVHDTSVVASAITRLLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Potri.010G063000 [exp]	0	1
AT4G15210		BAM5, AT-BETA-A...	REDUCED BETA AMYLASE 1, ARABID...		Potri.017G040800 [exp]	7.87	0.8991	Pt-BMY1.1
AT1G15670			Galactose oxidase/kelch repeat...		Potri.006G196900 [exp]	8.48	0.9141
AT1G65810			P-loop containing nucleoside t...		Potri.008G142960 [exp]	10.58	0.9218
AT1G54070			Dormancy/auxin associated fami...		Potri.001G164800 [exp]	16.43	0.9158
AT5G35390			Leucine-rich repeat protein ki...		Potri.006G078600 [exp]	16.55	0.9359
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.007G082900 [exp]	18.86	0.9251	Pt-IFS1.46
AT1G62760			Plant invertase/pectin methyle...		Potri.003G113600 [exp]	22.00	0.9194
AT3G14470			NB-ARC domain-containing disea...		Potri.006G275800 [exp]	28.61	0.9276
AT5G27370			Protein of unknown function (D...		Potri.013G027200 [exp]	30.39	0.9070
					Potri.002G056400 [exp]	30.80	0.8956

Compare expression of checked genes

Potri.010G063000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.