Potri.010G063100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13520 51 / 2e-10 SMAP1 small acidic protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G174000 84 / 1e-23 AT4G13520 54 / 2e-11 small acidic protein 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023702 66 / 3e-16 AT4G13520 48 / 2e-09 small acidic protein 1 (.1)
Lus10004400 63 / 2e-15 AT4G13520 52 / 5e-11 small acidic protein 1 (.1)
PFAM info
Representative CDS sequence
>Potri.010G063100.1 pacid=42798588 polypeptide=Potri.010G063100.1.p locus=Potri.010G063100 ID=Potri.010G063100.1.v4.1 annot-version=v4.1
ATGAGGCCGATGCAGGTAGACTTATTCGCAGACATGGAGGAGCAAGGATCGACTGTGGCGATGGACGTAGATGACGTGGACACACTGGAGATGTTCGGGG
AGGGAGTCATCAACATGGAAAACAAGCTCGCCGACGCCGATTTCTTCAACTATTTCGAAGACGATTTCGACGACTCCGACATCAACTAA
AA sequence
>Potri.010G063100.1 pacid=42798588 polypeptide=Potri.010G063100.1.p locus=Potri.010G063100 ID=Potri.010G063100.1.v4.1 annot-version=v4.1
MRPMQVDLFADMEEQGSTVAMDVDDVDTLEMFGEGVINMENKLADADFFNYFEDDFDDSDIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G13520 SMAP1 small acidic protein 1 (.1) Potri.010G063100 0 1
AT1G68310 AE7 AS1/2 ENHANCER7, Protein of un... Potri.003G098000 2.82 0.8282
AT1G57540 unknown protein Potri.005G002900 4.89 0.8226
AT4G13520 SMAP1 small acidic protein 1 (.1) Potri.008G174000 7.34 0.7886
AT1G29250 Alba DNA/RNA-binding protein (... Potri.018G029300 8.77 0.7771
AT3G13350 ARID HMG (high mobility group) box ... Potri.011G168800 10.39 0.7796
AT5G22280 unknown protein Potri.016G073500 11.22 0.7720
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Potri.017G030000 11.83 0.7879
AT5G59140 BTB/POZ domain-containing prot... Potri.009G037800 12.64 0.7243
AT5G16160 unknown protein Potri.017G116500 13.26 0.7195
AT3G56820 unknown protein Potri.006G026300 14.28 0.7660

Potri.010G063100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.