Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13450 195 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G03720 93 / 6e-24 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G17390 82 / 1e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G69080 79 / 6e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03290 78 / 2e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G44760 72 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G109000 [exp] 96 / 3e-24 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.015G060700 [exp] 95 / 4e-24 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.T170801 [exp] 95 / 8e-24 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G140200 [exp] 94 / 1e-23 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.002G084600 [exp] 67 / 2e-13 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G177100 [exp] 58 / 2e-10 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.011G039800 [exp] 40 / 0.0005 AT1G11360 269 / 3e-91 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014459 [exp] 216 / 2e-71 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10032598 [exp] 204 / 7e-67 AT4G13450 177 / 7e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10023716 [exp] 152 / 1e-47 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10043152 [exp] 151 / 9e-46 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10019173 [exp] 89 / 1e-21 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 78 / 2e-17 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007982 [exp] 71 / 9e-15 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025644 [exp] 64 / 1e-12 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10036814 [exp] 62 / 1e-12 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10018190 [exp] 56 / 8e-10 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.010G064800.1 pacid=42799912 polypeptide=Potri.010G064800.1.p locus=Potri.010G064800 ID=Potri.010G064800.1.v4.1 annot-version=v4.1 ATGGGGAGTGAGACCACTGCACGATCAAGAAAAGTAATGGTGGTGGCAGACCCAAGCCGCGAATCAGCAGGTGCGCTTCAATATGCACTATCCCATGTAG TTGTTGAGAATGATGAGCTCATACTTCTCCATGTCGAAAGTTCATATTCTTGGTGGAACACATTTTCGTTCAGAAAGATATATAGTCTAACGCCAGGTCC CATGCCCAACTCATCTGAAGGAGGCGGTGGAGTTGGGGAAGGTGACTTTCTTGAAGCAATGCGGCAGGTGTGCCGGATTGCCCAGCCAAAAATCCCTGTT CGCTTAGAAAGGACTCAGTTAATGGAGGAGACCAAGGACAAGGCGAATACTATCCTTAACAAAAGCAACCTGTTAAGGGTCGATCTTCTTATTATTGGCC AGAGACGAGGTTTCTCAACTGCAATATTAGGCACGAGCAGGTATAAACTGTCAGGAGGGTCGGGTACAAAGGGGTTAGATACAGCGGAGTATTTGATTGA GAACAGCAAGTGCACTTGTGTTGCAGTGCAGAAAAGAGGACAGAATGCAGGTTATGTGCTCAATACAAAAACCCACAAAAACTTCTGGCTCCTAGCATGA
AA sequence Show only first row Show all	>Potri.010G064800.1 pacid=42799912 polypeptide=Potri.010G064800.1.p locus=Potri.010G064800 ID=Potri.010G064800.1.v4.1 annot-version=v4.1 MGSETTARSRKVMVVADPSRESAGALQYALSHVVVENDELILLHVESSYSWWNTFSFRKIYSLTPGPMPNSSEGGGGVGEGDFLEAMRQVCRIAQPKIPV RLERTQLMEETKDKANTILNKSNLLRVDLLIIGQRRGFSTAILGTSRYKLSGGSGTKGLDTAEYLIENSKCTCVAVQKRGQNAGYVLNTKTHKNFWLLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G13450			Adenine nucleotide alpha hydro...		Potri.010G064800 [exp]	0	1
AT2G16910	bHLH	AMS, bHLH021	ABORTED MICROSPORES, basic hel...		Potri.009G136300 [exp]	50.06	0.6368
AT4G39920		TFCC, POR	TUBULIN-FOLDING COFACTOR C, PO...		Potri.007G093800 [exp]	115.12	0.6538
AT5G57500			Galactosyltransferase family p...		Potri.007G131000 [exp]	151.36	0.6443

Compare expression of checked genes

Potri.010G064800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.