Potri.010G065666 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21865 50 / 9e-08 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G172000 256 / 6e-88 AT4G21865 59 / 2e-11 unknown protein
Potri.014G192701 56 / 9e-10 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023724 121 / 4e-34 AT4G21865 55 / 2e-09 unknown protein
Lus10014471 114 / 2e-31 AT4G21865 47 / 1e-06 unknown protein
Lus10000264 43 / 5e-05 AT4G21865 42 / 8e-05 unknown protein
Lus10024951 43 / 6e-05 ND 37 / 0.004
Lus10022875 43 / 6e-05 ND 37 / 0.004
PFAM info
Representative CDS sequence
>Potri.010G065666.3 pacid=42798980 polypeptide=Potri.010G065666.3.p locus=Potri.010G065666 ID=Potri.010G065666.3.v4.1 annot-version=v4.1
ATGTATCCAAAGGTGAAGGTGAGAACAGATGGGCGAGACGATCAACATGCACACGACTGGAGTTCTTTGCTTTCCTTGAAAGATATCCAGTTTCTTTGTT
TGCAGGATTCTTGCGTTCCAGGTTGTTTCAGGATGTTGGGTGACAGATCGGCCGTAGCAGTACTCCGGGTGAAGGGGCACCAAGATGTTTCTCCACCAAT
CGTAGCAAGAATTCCGAAGTCTTATGTACCGAATGTAATCATGCCACAAGTTTCTGTTTCTGAAGAAGCAGAGAAGAAAAGCTATTCTACCGAGGAGGAT
AGACTGAATATTAGAGCCAGTTCGATCCCACGTCCACGTGCTGTCTTATCTAGTCCTGACAATGATGCGGTGATTGGAAGTAACAACAGGACTAAAGTGG
CACGACCTACAGCTTCAAAGAATAATAAGCTGATGGAAAGTAGACATGAACCATGTAAAGCTGTCCCCGGTCAAATCACTGATGCAAGTCCAACAAGTAC
AAGGAAGTCCAAGAACACTTCTGATAACAAGAGTGAGCTTAAAGTAAAGAAATGGTCACCACCTGAAGCATCCAGCCAGAGAAGAAAGATCGCAACCGAT
AAACCACGTTTCATGAGAATCTAA
AA sequence
>Potri.010G065666.3 pacid=42798980 polypeptide=Potri.010G065666.3.p locus=Potri.010G065666 ID=Potri.010G065666.3.v4.1 annot-version=v4.1
MYPKVKVRTDGRDDQHAHDWSSLLSLKDIQFLCLQDSCVPGCFRMLGDRSAVAVLRVKGHQDVSPPIVARIPKSYVPNVIMPQVSVSEEAEKKSYSTEED
RLNIRASSIPRPRAVLSSPDNDAVIGSNNRTKVARPTASKNNKLMESRHEPCKAVPGQITDASPTSTRKSKNTSDNKSELKVKKWSPPEASSQRRKIATD
KPRFMRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G21865 unknown protein Potri.010G065666 0 1
AT1G64140 unknown protein Potri.003G134200 1.00 0.8513
AT3G01170 Ribosomal protein L34e superfa... Potri.017G084500 3.46 0.8506
AT3G58040 SINAT2 seven in absentia of Arabidops... Potri.001G010500 8.06 0.8074
AT1G12450 SNARE associated Golgi protein... Potri.003G117400 9.89 0.8049
AT4G17900 PLATZ transcription factor fam... Potri.013G078500 10.67 0.7955
AT2G04550 DSPTP1E, IBR5 DUAL SPECIFICITY PROTEIN PHOSP... Potri.014G160500 14.07 0.8212 Pt-IBR5.1
AT4G14350 AGC (cAMP-dependent, cGMP-depe... Potri.011G157000 15.29 0.8247
AT5G46410 SSP4 SCP1-like small phosphatase 4 ... Potri.001G353700 16.06 0.8482
AT4G03030 Galactose oxidase/kelch repeat... Potri.002G041900 18.33 0.7718
AT5G63610 HEN3, CDKE;1, C... HUA ENHANCER 3, cyclin-depende... Potri.003G142900 19.28 0.8093 Pt-HEN3.2

Potri.010G065666 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.