Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPL23.6
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04400 278 / 3e-98 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) AT1G04480 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) ATCG00780 67 / 4e-15 ATCG00780.1, RPL14 ribosomal protein L14 (.1) AT1G17560 42 / 2e-05 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G171200 [exp] 281 / 1e-99 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.002G257500 [exp] 281 / 1e-99 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.011G127250 [exp] 190 / 1e-63 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G167700 [exp] 162 / 7e-53 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.003G136400 [exp] 159 / 2e-51 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.004G166200 [exp] 157 / 4e-51 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G022800 [exp] 44 / 8e-06 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023730 [exp] 281 / 2e-99 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) Lus10042695 [exp] 275 / 6e-97 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1) Lus10022881 [exp] 274 / 6e-96 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10011773 [exp] 274 / 9e-96 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10024943 [exp] 273 / 1e-95 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10020499 [exp] 252 / 3e-88 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1) Lus10012464 [exp] 252 / 3e-88 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10024942 [exp] 216 / 6e-74 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1) Lus10022882 [exp] 216 / 6e-74 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10008065 [exp] 92 / 2e-25 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00238 [poplar] [flax] Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence Show only first row Show all	>Potri.010G066400.1 pacid=42798356 polypeptide=Potri.010G066400.1.p locus=Potri.010G066400 ID=Potri.010G066400.1.v4.1 annot-version=v4.1 ATGTCGAAGCGAGGGCGTGGAGGATCAGCTGGTAACAAGTTCAGGATGTCACTGGGTCTGCCAGTGGCAGCAACAGTGAACTGTGCTGATAACACTGGTG CTAAGAACCTTTACATCATCTCCGTGAAGGGAATCAAGGGTCGTTTGAACCGTTTACCTTCTGCTTGCGTTGGTGATATGGTTATGGCCACTGTCAAGAA GGGGAAGCCTGATCTCAGGAAGAAGGTCATGCCTGCTGTCATTGTTAGGCAGCGTAAGCCTTGGCGCCGAAAGGACGGTGTTTTCATGTACTTTGAAGAT AATGCTGGTGTCATCGTGAACCCTAAAGGAGAAATGAAAGGCTCTGCAATTACTGGTCCAATTGGAAAGGAGTGCGCTGATCTTTGGCCAAGGATTGCAA GTGCAGCCAATGCCATCGTTTAA
AA sequence Show only first row Show all	>Potri.010G066400.1 pacid=42798356 polypeptide=Potri.010G066400.1.p locus=Potri.010G066400 ID=Potri.010G066400.1.v4.1 annot-version=v4.1 MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFED NAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.010G066400 [exp]	0	1	Pt-RPL23.6
AT4G36130			Ribosomal protein L2 family (....		Potri.007G013101 [exp]	1.00	0.9585
AT1G57860			Translation protein SH3-like f...		Potri.006G195400 [exp]	3.74	0.9454
AT1G07070			Ribosomal protein L35Ae family...		Potri.010G194200 [exp]	3.87	0.9172
AT3G13674			unknown protein		Potri.018G082800 [exp]	4.12	0.8798
AT5G64140		RPS28	ribosomal protein S28 (.1)		Potri.010G245400 [exp]	5.29	0.8870	Pt-RPS28.1
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.001G131000 [exp]	6.00	0.9251	ATBBC1.2
AT5G45775			Ribosomal L5P family protein (...		Potri.006G181501 [exp]	6.00	0.8939
AT5G23290		PFD5, PDF5	prefoldin 5 (.1)		Potri.007G074042 [exp]	6.78	0.8653
AT2G39390			Ribosomal L29 family protein ...		Potri.010G212300 [exp]	6.92	0.9299	RPL35.2
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.009G090000 [exp]	7.93	0.9032

Compare expression of checked genes

Potri.010G066400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.