Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PGR5.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G05620 173 / 5e-57 PGR5 proton gradient regulation 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G171000 [exp] 204 / 3e-69 AT2G05620 179 / 2e-59 proton gradient regulation 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023734 [exp] 167 / 1e-54 AT2G05620 193 / 5e-65 proton gradient regulation 5 (.1) Lus10011777 [exp] 165 / 8e-54 AT2G05620 194 / 2e-65 proton gradient regulation 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G066900.1 pacid=42799881 polypeptide=Potri.010G066900.1.p locus=Potri.010G066900 ID=Potri.010G066900.1.v4.1 annot-version=v4.1 ATGGCTTCTTCAATTTCTGCAACTGGGTTTAAGGGAGGTTTTGGGACTGCGTTTATGGGAAGTTGGGGCACTTCAATTGTTGGCGAAGACTATGCCATGT TGGTTAAGCCAGTGCCAAGCCATGTTAGAGTTGCGAAGCCAGTGAAATCGCCTCCCATGATGAAGAATGTCAATGAAGGAAAGGGTCTTTTTGCTCCTGC TGTTGTTATCACACGTCAAATAATCGGCAAGAAAAGGTTCAATCAGCTTAGAGGCAAAGCAATCGCCTTACACTCACAGGTGATTACTGAGTTCTGCAAA TCGATAGGAGCAGATGCAAAACAAAGGCAGGGACTGATTAGGTTGGCCAAGAAGAATGGAGAGAGACTCGGGTTCCTTGCTTGA
AA sequence Show only first row Show all	>Potri.010G066900.1 pacid=42799881 polypeptide=Potri.010G066900.1.p locus=Potri.010G066900 ID=Potri.010G066900.1.v4.1 annot-version=v4.1 MASSISATGFKGGFGTAFMGSWGTSIVGEDYAMLVKPVPSHVRVAKPVKSPPMMKNVNEGKGLFAPAVVITRQIIGKKRFNQLRGKAIALHSQVITEFCK SIGADAKQRQGLIRLAKKNGERLGFLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G05620		PGR5	proton gradient regulation 5 (...		Potri.010G066900 [exp]	0	1	Pt-PGR5.1
AT3G47070			unknown protein		Potri.001G249600 [exp]	1.00	0.9768
AT2G03420			unknown protein		Potri.010G161400 [exp]	3.46	0.9750
AT4G37980		ELI3-1, ATCAD7	CINNAMYL-ALCOHOL DEHYDROGENASE...		Potri.006G199100 [exp]	5.47	0.9543	ELI3.1
AT5G01410		PDX1, ATPDX1.3,...	REDUCED SUGAR RESPONSE 4, ARAB...		Potri.016G116400 [exp]	6.70	0.9574	Pt-PDX1.2
AT1G55480		ZKT	protein containing PDZ domain,...		Potri.003G222200 [exp]	7.14	0.9676
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Potri.015G078100 [exp]	8.48	0.9629
AT3G01060			unknown protein		Potri.017G090100 [exp]	8.94	0.9646
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Potri.008G187400 [exp]	10.24	0.9624	Pt-AOAT1.2
AT4G28740			unknown protein		Potri.014G194500 [exp]	14.07	0.9568
AT5G19855		AtRbcX2	homologue of cyanobacterial Rb...		Potri.009G053300 [exp]	14.28	0.9510

Compare expression of checked genes

Potri.010G066900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.