Potri.010G069500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28556 99 / 7e-25 RIC7 PAK-box/P21-Rho-binding family protein (.1)
AT3G23380 98 / 1e-24 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
AT2G33460 99 / 2e-24 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1)
AT2G20430 97 / 6e-24 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1)
AT1G04450 94 / 8e-23 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1)
AT4G04900 82 / 7e-19 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1)
AT1G03982 65 / 2e-12 PAK-box/P21-Rho-binding family protein (.1)
AT4G21745 64 / 4e-12 PAK-box/P21-Rho-binding family protein (.1)
AT1G61795 62 / 6e-12 PAK-box/P21-Rho-binding family protein (.1)
AT5G16490 47 / 2e-06 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168900 218 / 3e-70 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Potri.005G227500 110 / 9e-29 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1)
Potri.002G035500 108 / 5e-28 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1)
Potri.011G025300 103 / 3e-27 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.004G020650 101 / 2e-26 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1)
Potri.002G233400 57 / 2e-09 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.014G147000 50 / 3e-07 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.013G086600 46 / 4e-06 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Potri.019G053300 44 / 4e-05 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011805 100 / 5e-25 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10003625 94 / 3e-23 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10008243 91 / 4e-22 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1)
Lus10018362 91 / 5e-22 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10007648 87 / 1e-20 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10006763 84 / 1e-19 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1)
Lus10021168 77 / 2e-15 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1)
Lus10020060 53 / 6e-08 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00786 PBD P21-Rho-binding domain
Representative CDS sequence
>Potri.010G069500.1 pacid=42798368 polypeptide=Potri.010G069500.1.p locus=Potri.010G069500 ID=Potri.010G069500.1.v4.1 annot-version=v4.1
ATGTTTGATGTGCGATCACTGGCATTGCCGCAGCTACCATGGGATCGTCTTGACTTCTTGTTTTTCGTTTTCTTTTCCCCCAAGAAGCAATATTTCAACA
AACGAAGCAACCTTGCTGGCGCAGCTAAATTGCCTGGCTTGGCCAAAATGACAACCAAAGTGAAAGGTCTTTTGAGAGGTCTAAGATACATTTCACAAAT
ATTTGATGAAAAGGAACAAGAAATGCAAATTGGATTGCCTACTGATGTAAAACATGTTGCTCACATTGGATGGGATGGCCCGTCTGCAAATGCACCAAGC
TGGATGAATGAGTTCACCTCGCCTCCAGAAATTTTAAGTGGGACTTCAAATTCTACAGAAGTGAAGAGCCTTTCAACAGATTCAACCTTGGAAGGTCAAA
CTGAAAAGCCGAAGCATAGTTCAAGGCTCTCATCGGGTAGTGCTAGCTCACTTTTAAATTCCCCAGACCGAAGGAGTACCGACTCATCAAAGCACTCCAG
GCGCCAAGCATCTAGCAGTACTGGCTCACCTTTAAATTCCCCCAGTGGCACTGATGCGCCAAAGAGTTCTAGGCGTCACCGCTCTTCAAACAAGTCAATG
GACTCTCCAAGGGAAGAATCATCAGGGAGCAGCCGAACCTCAAGACGACACAAGACCTCAAGTCTTGGTGCTGAATCGCCTATTCAAGACCAGCCCACCA
TCCCAAAGCATTCTCGTGGAAGAAAGTCCAAGGGATCATCAAGATCAAAAGAAAAGAACTCTTCAAACGAAGCGCTTCCTTTCTCGGATCCTGGACCTGG
AGGGTCTGAGTCTATACATGGAAGGAAGAACACTGCAAGCCAACTAAGTTCTGTTTTGGAAGCATATGAAGAAGAGCGATGA
AA sequence
>Potri.010G069500.1 pacid=42798368 polypeptide=Potri.010G069500.1.p locus=Potri.010G069500 ID=Potri.010G069500.1.v4.1 annot-version=v4.1
MFDVRSLALPQLPWDRLDFLFFVFFSPKKQYFNKRSNLAGAAKLPGLAKMTTKVKGLLRGLRYISQIFDEKEQEMQIGLPTDVKHVAHIGWDGPSANAPS
WMNEFTSPPEILSGTSNSTEVKSLSTDSTLEGQTEKPKHSSRLSSGSASSLLNSPDRRSTDSSKHSRRQASSSTGSPLNSPSGTDAPKSSRRHRSSNKSM
DSPREESSGSSRTSRRHKTSSLGAESPIQDQPTIPKHSRGRKSKGSSRSKEKNSSNEALPFSDPGPGGSESIHGRKNTASQLSSVLEAYEEER

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G28556 RIC7 PAK-box/P21-Rho-binding family... Potri.010G069500 0 1
Potri.015G004900 10.04 0.9559
Potri.007G040950 18.08 0.9543
Potri.008G135001 20.49 0.9542
AT3G04380 SDG31, SUVR4 SET DOMAIN PROTEIN 31, SET-dom... Potri.009G138600 23.55 0.9541
AT4G30420 nodulin MtN21 /EamA-like trans... Potri.006G177800 24.24 0.9538
AT2G38870 Serine protease inhibitor, pot... Potri.010G075800 33.01 0.9530
AT1G30870 Peroxidase superfamily protein... Potri.010G175100 37.81 0.9527
Potri.009G036600 40.47 0.9526
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Potri.005G224700 40.80 0.9526 GY4.2
AT3G07870 F-box and associated interacti... Potri.001G224200 42.33 0.9496

Potri.010G069500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.