Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25400 165 / 8e-54 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G168700 [exp] 219 / 2e-75 AT3G25400 170 / 9e-56 unknown protein Potri.014G148200 [exp] 169 / 3e-55 AT3G25400 175 / 2e-57 unknown protein Potri.002G235000 [exp] 164 / 3e-53 AT3G25400 134 / 5e-41 unknown protein Potri.002G250000 [exp] 157 / 7e-51 AT3G25400 151 / 3e-48 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003475 [exp] 170 / 7e-56 AT3G25400 164 / 3e-53 unknown protein Lus10015730 [exp] 161 / 2e-52 AT3G25400 157 / 1e-50 unknown protein Lus10009588 [exp] 161 / 5e-52 AT3G25400 177 / 5e-58 unknown protein Lus10020407 [exp] 160 / 6e-52 AT3G25400 178 / 1e-58 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0231 [poplar] [flax] MazG PF03819 [poplar] [flax] MazG MazG nucleotide pyrophosphohydrolase domain
Representative CDS sequence Show only first row Show all	>Potri.010G069700.1 pacid=42798580 polypeptide=Potri.010G069700.1.p locus=Potri.010G069700 ID=Potri.010G069700.1.v4.1 annot-version=v4.1 ATGGAAGAAACAGAAGAGATCTCTATTGCAGAAGAGAAAGTAGTGGACATTAGTCTCAAGGACCTTGCCAAGAAACTAGAGGAATTTGCCAAGGCCAGAG ATTGGGAAAAGTACCATAGTCCAAGAAATCTCCTTCTTGCAATGGTTGGCGAAGTAGGAGAGCTATCGGAAATATTCCAATGGAAAGGAGAGGTGGACAA GGGGTTGCCAAACTGGGAGGAATCTGACAAGGAGCATCTAGCAGAAGAGCTATCTGATGTGCTGCTATACCTCATTAGATTGTCTGATATTTGTGGCATT GATCTTGGTGATGCTGCCACCAAAAAAATTGTGAAGAACGCTATCAAATACCCACCCAAGGCCTGCTGA
AA sequence Show only first row Show all	>Potri.010G069700.1 pacid=42798580 polypeptide=Potri.010G069700.1.p locus=Potri.010G069700 ID=Potri.010G069700.1.v4.1 annot-version=v4.1 MEETEEISIAEEKVVDISLKDLAKKLEEFAKARDWEKYHSPRNLLLAMVGEVGELSEIFQWKGEVDKGLPNWEESDKEHLAEELSDVLLYLIRLSDICGI DLGDAATKKIVKNAIKYPPKAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25400			unknown protein		Potri.010G069700 [exp]	0	1
AT2G43290		MSS3	multicopy suppressors of snf4 ...		Potri.008G079066 [exp]	6.92	0.9395
AT1G32250			Calcium-binding EF-hand family...		Potri.014G030200 [exp]	11.66	0.9284
AT5G16550			unknown protein		Potri.004G082300 [exp]	14.89	0.7576
AT3G62290		ATARFA1E	ADP-ribosylation factor A1E (....		Potri.001G301200 [exp]	15.00	0.9259
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.002G035000 [exp]	16.73	0.9205
AT4G05050		UBQ11	ubiquitin 11 (.1.2.3.4)		Potri.006G045300 [exp]	18.84	0.9190
AT1G05990		RHS1 ,RHS2	ROOT HAIR SPECIFIC 1, EF hand ...		Potri.008G079132 [exp]	20.19	0.9072
AT2G16050			Cysteine/Histidine-rich C1 dom...		Potri.009G170201 [exp]	21.16	0.9125
					Potri.003G138700 [exp]	25.69	0.9078
AT1G16310			Cation efflux family protein (...		Potri.010G172900 [exp]	26.64	0.8630

Compare expression of checked genes

Potri.010G069700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.