Plant FIBer expression Database

Potri.010G069900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
AT2G20450 226 / 1e-77 Ribosomal protein L14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168600
[exp]
254 / 9e-89 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1)
Potri.005G227300
[exp]
246 / 8e-86 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1)
Potri.002G035700
[exp]
244 / 3e-85 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024918
[exp]
237 / 3e-82 AT2G20450 224 / 3e-77 Ribosomal protein L14 (.1)
Lus10008246
[exp]
235 / 2e-81 AT2G20450 228 / 8e-79 Ribosomal protein L14 (.1)
Lus10011807
[exp]
228 / 1e-78 AT2G20450 221 / 9e-76 Ribosomal protein L14 (.1)
Lus10021170
[exp]
226 / 1e-77 AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1)
Lus10003627
[exp]
140 / 2e-44 AT4G27090 139 / 2e-44 Ribosomal protein L14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01929 Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence
>Potri.010G069900.1 pacid=42798490 polypeptide=Potri.010G069900.1.p locus=Potri.010G069900 ID=Potri.010G069900.1.v4.1 annot-version=v4.1
ATGCCTTTCAAGAGATACGTGGAGATCGGGAGGGTAGGTCTCGTCAACTATGGAAAAGAATACGGCAGGATCGTTGTTATCGTTGATGTCATCGACCAGA
ACCGCGCTCTGGTTGATGCCCCAGATATGGTGAGGAGCCAAATGAACTTCAAGAGAATCTCACTCACCGATATCAAGATTGATATCAACCGGGTTCCAAA
GAAGAAGGCTTTGATTGAAGCCATGGAGAAGGCTGATGTTAAGAACAAGTGGGAGAATAGCTCTTGGGGCAGAAGGCTGATTGTTCAGAAGAGAAGGGCA
GCTCTCAATGACTTCGATCGGTTCAAGTTGATGTTGGCTAAGATCAAGAGGGGTGGATTGATCAGGCAAGAACTTGCGAAGTTGAAGAAAGAAAGTGTTG
CTTAA
AA sequence
>Potri.010G069900.1 pacid=42798490 polypeptide=Potri.010G069900.1.p locus=Potri.010G069900 ID=Potri.010G069900.1.v4.1 annot-version=v4.1
MPFKRYVEIGRVGLVNYGKEYGRIVVIVDVIDQNRALVDAPDMVRSQMNFKRISLTDIKIDINRVPKKKALIEAMEKADVKNKWENSSWGRRLIVQKRRA
ALNDFDRFKLMLAKIKRGGLIRQELAKLKKESVA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G27090 Ribosomal protein L14 (.1) Potri.010G069900
[exp]
0 1
AT3G05560 Ribosomal L22e protein family ... Potri.014G128800
[exp]
1.41 0.9662 RPL22.2
AT4G10450 Ribosomal protein L6 family (.... Potri.011G147700
[exp]
6.92 0.9471 Pt-RPL9.4
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.002G140400
[exp]
7.34 0.9436 Pt-RPS11.5
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.008G175500
[exp]
8.24 0.9272
AT4G15000 Ribosomal L27e protein family ... Potri.016G019000
[exp]
8.66 0.9399 RPL27.1
AT5G02960 Ribosomal protein S12/S23 fami... Potri.008G044400
[exp]
10.95 0.9280 Pt-RPS23.3
AT5G02960 Ribosomal protein S12/S23 fami... Potri.016G085800
[exp]
12.32 0.9414 Pt-RPS23.5
AT3G56340 Ribosomal protein S26e family ... Potri.019G057000
[exp]
16.43 0.9369 RPS26.2
AT5G09500 Ribosomal protein S19 family p... Potri.002G043200
[exp]
16.43 0.9340
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106466
[exp]
18.65 0.9305

Potri.010G069900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.