Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39840 55 / 2e-10 TOPP4 type one serine/threonine protein phosphatase 4 (.1) AT5G59160 54 / 8e-10 PPO, TOPP2 PROTOPORPHYRINOGEN OXIDASE, type one serine/threonine protein phosphatase 2 (.1.2.3) AT4G11240 54 / 8e-10 TOPP7 Calcineurin-like metallo-phosphoesterase superfamily protein (.1) AT5G43380 53 / 2e-09 TOPP6 type one serine/threonine protein phosphatase 6 (.1.2.3) AT1G64040 52 / 2e-09 TOPP3 type one serine/threonine protein phosphatase 3 (.1) AT2G29400 49 / 3e-08 PP1-AT, TOPP1 type one protein phosphatase 1 (.1) AT3G46820 47 / 1e-07 TOPP5 type one serine/threonine protein phosphatase 5 (.1) AT5G27840 41 / 3e-05 TOPP8 Calcineurin-like metallo-phosphoesterase superfamily protein (.1.2) AT3G05580 40 / 4e-05 TOPP9 type one protein phosphatase 9, Calcineurin-like metallo-phosphoesterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G166300 [exp] 107 / 1e-29 AT2G39840 545 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Potri.010G071850 [exp] 84 / 5e-23 AT2G39840 40 / 2e-05 type one serine/threonine protein phosphatase 4 (.1) Potri.013G045900 [exp] 59 / 1e-11 AT2G39840 564 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Potri.019G018000 [exp] 58 / 2e-11 AT2G39840 554 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Potri.001G098600 [exp] 56 / 1e-10 AT4G11240 582 / 0.0 Calcineurin-like metallo-phosphoesterase superfamily protein (.1) Potri.010G197600 [exp] 55 / 3e-10 AT2G39840 602 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Potri.008G060800 [exp] 54 / 5e-10 AT2G39840 594 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Potri.001G245700 [exp] 49 / 2e-08 AT2G29400 556 / 0.0 type one protein phosphatase 1 (.1) Potri.009G037700 [exp] 47 / 2e-07 AT5G59160 553 / 0.0 PROTOPORPHYRINOGEN OXIDASE, type one serine/threonine protein phosphatase 2 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021872 [exp] 67 / 1e-14 AT2G39840 523 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10042559 [exp] 64 / 2e-13 AT2G39840 564 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10022019 [exp] 62 / 1e-12 AT2G39840 565 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10001025 [exp] 55 / 3e-10 AT2G39840 602 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10030163 [exp] 55 / 4e-10 AT2G39840 602 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10004692 [exp] 52 / 2e-09 AT2G39840 596 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10040259 [exp] 51 / 7e-09 AT2G39840 590 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10011827 [exp] 50 / 2e-08 AT2G39840 513 / 0.0 type one serine/threonine protein phosphatase 4 (.1) Lus10016489 [exp] 49 / 3e-08 AT5G59160 570 / 0.0 PROTOPORPHYRINOGEN OXIDASE, type one serine/threonine protein phosphatase 2 (.1.2.3) Lus10001555 [exp] 49 / 5e-08 AT5G59160 470 / 2e-169 PROTOPORPHYRINOGEN OXIDASE, type one serine/threonine protein phosphatase 2 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G072101.1 pacid=42797015 polypeptide=Potri.010G072101.1.p locus=Potri.010G072101 ID=Potri.010G072101.1.v4.1 annot-version=v4.1 ATGGGGAAACAAAATGTCGAGAGGAGAGAATTTTGTAATAGGAGAAATAGCTCTCTGCCTGAGTTTGACAATGCTGGTGCCATGATGACCATGGATGAGA ATCCACAATGTTCTTTCCAAATACTGAGACCTGCAGCGAAGAAGCCAAAATTTGGCGTTGGGAGCACTGTTACAGCTAAGAGTGGCACCATTCCACATAA AATCAAGGTATATGCCGTCCACCCTGCTCCTCGTATACATACCTGTTATTTTATTTACAAATAA
AA sequence Show only first row Show all	>Potri.010G072101.1 pacid=42797015 polypeptide=Potri.010G072101.1.p locus=Potri.010G072101 ID=Potri.010G072101.1.v4.1 annot-version=v4.1 MGKQNVERREFCNRRNSSLPEFDNAGAMMTMDENPQCSFQILRPAAKKPKFGVGSTVTAKSGTIPHKIKVYAVHPAPRIHTCYFIYK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.010G072101 [exp]	0	1
AT1G78260			RNA-binding (RRM/RBD/RNP motif...		Potri.002G098100 [exp]	13.63	0.8034
					Potri.001G132166 [exp]	31.68	0.7912
AT1G04880	ARID		HMG (high mobility group) box ...		Potri.001G315200 [exp]	34.20	0.7723
AT5G57770			Plant protein of unknown funct...		Potri.018G099000 [exp]	55.85	0.7555
AT1G79210			N-terminal nucleophile aminohy...		Potri.012G123100 [exp]	58.73	0.7569
					Potri.011G012201 [exp]	68.70	0.7592
AT5G49800			Polyketide cyclase/dehydrase a...		Potri.004G231000 [exp]	75.82	0.7456
					Potri.018G004701 [exp]	85.44	0.7222
					Potri.005G106151 [exp]	112.00	0.7404
AT3G06070			unknown protein		Potri.008G204100 [exp]	155.33	0.7263

Compare expression of checked genes

Potri.010G072101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.