Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06620 471 / 6e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06650 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G59540 457 / 8e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G06645 443 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30840 442 / 8e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59530 441 / 1e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06640 439 / 9e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT1G04350 439 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 436 / 1e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 408 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G073232 [exp] 553 / 0 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 513 / 0 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G156200 [exp] 470 / 1e-166 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G165400 [exp] 459 / 1e-162 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 448 / 4e-158 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.013G045000 [exp] 374 / 6e-129 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G135800 [exp] 363 / 3e-124 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G222300 [exp] 360 / 3e-123 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 355 / 2e-121 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022191 [exp] 482 / 2e-171 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021943 [exp] 481 / 4e-171 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022193 [exp] 469 / 2e-166 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027586 [exp] 461 / 2e-163 AT1G06620 449 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 453 / 8e-160 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 449 / 2e-158 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 449 / 2e-158 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022415 [exp] 443 / 4e-156 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10001103 [exp] 441 / 3e-155 AT1G06620 427 / 2e-149 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021203 [exp] 440 / 1e-154 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.010G073166.1 pacid=42797993 polypeptide=Potri.010G073166.1.p locus=Potri.010G073166 ID=Potri.010G073166.1.v4.1 annot-version=v4.1 ATGGCGACGACATGCGATTCCAGTTATGATCGAATAAGCGAATTAAAAGCTTTCGACGACACAAAGGCCGGTGTCAAAGGACTTGTTGATGCTGGAATCA CCAAGGTACCGCGAATTTTCCATCACCTACGTGATGATTCAGACAATACTTTGCTTGTCGCTGCTGAAGGAAAGTTCAGAATTCCGATGATAGACCTGGA AGATGTCCATAAAGGTCCACCTCAACGCAAGGAGATTGTTGACAGAGTCCGAAATGCATCAGAGACTTGGGGCTTTTTTGAAGTGGTCAATCATGGGATT CCAGTAGATGTTCTGGAGGAGATGAAGGATGGGGTACGTAGGTTTTATGAGCAAGATGTTGAGCTGAAAAAAGAATACTTCTCTCGAGACCATACGAGAA AGGTTGGGTATAATAGCAACTTTGATTTGTTTAGTTCACCATCAGCTAATTGGAGAGACACCTTTACCTGTGTCATGGCTCCCATTTCTCCCAGGCCAGA AGAGTTGCCAGCCGCATTCAGAGATATTCTCATAGAATACACCAAGGAAGTAATGAAATTGGGAAATTCACTGTTCGAGTTACTATCAGAGGCTCTTGGT TTGAACCCCAACCACTTGAAAGACATTGATTGCAGCAAGGGGCTTACAATTCTGGGCCATTATTATCCGGCGTGTCCCCAGCCAGAATTGACGTTGGGTA CAACTAAGCACTCTGATAATGACTTCCTCACAGTGCTTCTACAAGATCATATTGGTGGCCTCCAGGTTATGTATCAGAATCATTGGGTTGATGTACCTCC TACGCCTGGGGCTCTGTTGATTAACATTGGAGATCTTCTACAGCTTATATCAAATGACAAGTTCATAAGCGTTGAGCATAGGGTGCTGGCAAACCGTATA GGACCAAGAGTATCTGTAGCGAGCTTTTTCAGCACAAATCTTAATCCAAACTCAAGACCCTATGGACCTATCAAGGAGTTGTTATCAGAAGAGAGTCCTC CAAAGTACAGGGAAACCACAGTAAGAGATTATGTTGCCTACTTCATCCACAAAGGCCTTGACGGGACATCTGCTCTGCTGCATTTCAAGCTGTGA
AA sequence Show only first row Show all	>Potri.010G073166.1 pacid=42797993 polypeptide=Potri.010G073166.1.p locus=Potri.010G073166 ID=Potri.010G073166.1.v4.1 annot-version=v4.1 MATTCDSSYDRISELKAFDDTKAGVKGLVDAGITKVPRIFHHLRDDSDNTLLVAAEGKFRIPMIDLEDVHKGPPQRKEIVDRVRNASETWGFFEVVNHGI PVDVLEEMKDGVRRFYEQDVELKKEYFSRDHTRKVGYNSNFDLFSSPSANWRDTFTCVMAPISPRPEELPAAFRDILIEYTKEVMKLGNSLFELLSEALG LNPNHLKDIDCSKGLTILGHYYPACPQPELTLGTTKHSDNDFLTVLLQDHIGGLQVMYQNHWVDVPPTPGALLINIGDLLQLISNDKFISVEHRVLANRI GPRVSVASFFSTNLNPNSRPYGPIKELLSEESPPKYRETTVRDYVAYFIHKGLDGTSALLHFKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Potri.010G073166 [exp]	0	1
AT3G62410		CP12-2	CP12 DOMAIN-CONTAINING PROTEIN...		Potri.014G120700 [exp]	1.00	0.9860
AT1G68590			Ribosomal protein PSRP-3/Ycf65...		Potri.004G101000 [exp]	1.73	0.9670
AT1G30260		AGL79	unknown protein		Potri.011G081001 [exp]	4.47	0.9629
AT3G23360			Protein phosphatase 2C family ...		Potri.010G070100 [exp]	4.89	0.9539
AT4G00030			Plastid-lipid associated prote...		Potri.014G058400 [exp]	7.48	0.9575
AT5G10600		CYP81K2	"cytochrome P450, family 81, s...		Potri.014G021400 [exp]	7.74	0.9505	Pt-IFS1.54
AT2G20690			lumazine-binding family protei...		Potri.019G100500 [exp]	8.12	0.9546
AT3G13730		CYP90D1	"cytochrome P450, family 90, s...		Potri.003G038200 [exp]	10.67	0.9298
AT4G14870		SECE1	secE/sec61-gamma protein trans...		Potri.008G153400 [exp]	10.90	0.9618
AT1G13480			Protein of unknown function (D...		Potri.008G109400 [exp]	11.35	0.9342

Compare expression of checked genes

Potri.010G073166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.